UniProt ID | JAL29_ARATH | |
---|---|---|
UniProt AC | O04316 | |
Protein Name | Nitrile-specifier protein 4 | |
Gene Name | NSP4 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 619 | |
Subcellular Localization | ||
Protein Description | Promotes simple nitriles, but not epithionitrile or thiocyanate formation. Converts allylglucosinolate and benzylglucosinolate to their corresponding simple nitriles in the presence of myrosinase.. | |
Protein Sequence | MAQKVEAQGGNGGNQWDDGSEYDAVTKIQVAAGGNGIEYVKFTYVKNGQTEEAPLRGVKGRSFEADPFVINHPEEHLVSVEGRYNPEGLILGLTFKSNKKTSDLIGYEDGTPFTLQVQDKKIVGFYGFAGNNLHSLGAYFAPLTNVTPLNAKKLEAKGGDTGDIWDDGVYDNVRKVYVGQAQYGIAFVKFEYVNGSQVVVGDEHGKKTELGVEEFEIDADDYIVYVEGYREKVNGMTSEMITFLSFKTYKGKTSQPIEQRPGIKFVLQGGKIVGFHGRSTDVLDSLGAYISLSPTPNLHGKWTKVDENGDGPGLRCSHDIAQVGNKIYSFGGEFTPNQPIDKHLYVFDIESRTWSISPATGDIPTLSCLGVCMVSIGSTLYVFGGRDASRQYNGFYSFDTTTNEWKLLTPVEEGPTPRSFHSMAADEENVYVFGGVSATARLNTLDSYNIVDKKWFHCSTPGDSLTARGGAGLEVVQGKVWVVYGFNGCEVDDVHYYDPVQDKWTQVETFGVRPSERSVFASAALGKHIVIFGGEIAMDPLAHVGPGQLTDGTFALDTETLQWERLDKFGGEEETPSSRGWTASTTATIGGKKGLVMHGGKAPTNDRFDDLFFYGIDSA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
196 | Phosphorylation | KFEYVNGSQVVVGDE EEEEECCCEEEEECC | 30407730 | ||
335 | Phosphorylation | YSFGGEFTPNQPIDK EECCCCCCCCCCCCC | 23328941 | ||
409 | Phosphorylation | TNEWKLLTPVEEGPT CCEEEEECCCCCCCC | 23776212 | ||
416 | Phosphorylation | TPVEEGPTPRSFHSM CCCCCCCCCCCHHHC | 23776212 | ||
575 | Phosphorylation | KFGGEEETPSSRGWT HCCCCCCCCCCCCCE | 19880383 | ||
577 | Phosphorylation | GGEEETPSSRGWTAS CCCCCCCCCCCCEEE | 19880383 | ||
578 | Phosphorylation | GEEETPSSRGWTAST CCCCCCCCCCCEEEE | 30407730 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of JAL29_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of JAL29_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of JAL29_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of JAL29_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...