dbPTM

JAG_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	JAG_ARATH
UniProt AC	Q6S591
Protein Name	Zinc finger protein JAGGED
Gene Name	JAG
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	253
Subcellular Localization	Nucleus .
Protein Description	Controls the morphogenesis of lateral organs. Functions in lateral organ shape and is sufficient to induce proliferation and growth of lateral organ tissue. Is necessary and sufficient for bract formation, but its expression is excluded from the cryptic bract, which could be a cause of bractless flowers in Arabidopsis. Participates with FIL and YAB3 in regulating valve margin development. Functions with JGL to define stamen and carpel shape. Functions with AS1 and AS2 in the sepal and petal primordia to repress boundary-specifying genes for normal development of the organs..
Protein Sequence	MRHEENYLDLNNLPDDFSKDGNKQALEEGSSSGQRKKKGSKEGKDESGKVYECRFCSLKFCKSQALGGHMNRHRQERETETLNQARQLVYRNDTITPPGISPFGYHHTTDPTIYRSVYSSPMIYPGSSSTNLVPQPPMPPPPPPYPYSSNQYSPHNHFNDYYLNPSFRGSRSISPSPNLPTTTTVDYMADSPVEPGYTCVGAPIGPTGFPIRGPSIVRAPLEPPQGRDGDASRQRLDHSLRFPINRFQDHHSL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of JAG_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of JAG_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of JAG_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of JAG_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
GAT18_ARATH	MNP	physical	26390296

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of JAG_ARATH

Related Literatures of Post-Translational Modification