ITM2B_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ITM2B_MOUSE
• UniProt AC: O89051
• Protein Name: Integral membrane protein 2B
• Gene Name: Itm2b
• Organism: Mus musculus (Mouse).
• Sequence Length: 266
• Subcellular Localization: Integral membrane protein 2B: Golgi apparatus membrane ; Single-pass type II membrane protein . Immature BRI2 (imBRI2) is cleaved by furin in the Golgi into mBRI2 and a Bri23 peptide. mBRI2 is transported to the plasma membrane and Bri23 peptide is s
• Protein Description: Plays a regulatory role in the processing of the amyloid-beta A4 precursor protein (APP) and acts as an inhibitor of the amyloid-beta peptide aggregation and fibrils deposition. Plays a role in the induction of neurite outgrowth. Functions as a protease inhibitor by blocking access of secretases to APP cleavage sites (By similarity).; Mature BRI2 (mBRI2) functions as a modulator of the amyloid-beta A4 precursor protein (APP) processing leading to a strong reduction in the secretion of secretase-processed amyloid-beta protein 40 and amyloid-beta protein 42.; Bri23 peptide prevents aggregation of APP amyloid-beta protein 42 into toxic oligomers..
• Protein Sequence: MVKVTFNSALAQKEAKKDEPKSSEEALIVPPDAVAVDCKDPGDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGLKYIKDDVILNEPSADAPAARYQTIEENIKIFEEDAVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPKNLLELLINIKAGTYLPQSYLIHEHMVITDRIENVDNLGFFIYRLCHDKETYKLQRRETIRGIQKREASNCFTIRHFENKFAVETLICS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Ubiquitination	-----MVKVTFNSAL -----CCEEEECHHH	33.97	22790023
13	Ubiquitination	FNSALAQKEAKKDEP ECHHHHHHHHCCCCC	54.77	22790023
16	Ubiquitination	ALAQKEAKKDEPKSS HHHHHHHCCCCCCCC	62.95	22790023
17	Ubiquitination	LAQKEAKKDEPKSSE HHHHHHCCCCCCCCC	74.50	22790023
21	Ubiquitination	EAKKDEPKSSEEALI HHCCCCCCCCCCCEE	65.65	-
39	Ubiquitination	DAVAVDCKDPGDVVP CCEEECCCCCCCCCC	63.59	22790023
170	N-linked_Glycosylation	KCYVIPLNTSIVMPP CEEEEECCCCEECCC	26.82	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ITM2B_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
170	N	Glycosylation	Glycosylation at Asn-170 is important for cell surface localization, but doesn't affect furin- and ADAM10-induced proteolytic processing.	-

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ITM2B_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of ITM2B_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.