ITB2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ITB2_MOUSE
• UniProt AC: P11835
• Protein Name: Integrin beta-2
• Gene Name: Itgb2
• Organism: Mus musculus (Mouse).
• Sequence Length: 771
• Subcellular Localization: Cell membrane ; Single-pass type I membrane protein . Membrane raft ; Single-pass type I membrane protein .
• Protein Description: Integrin ITGAL/ITGB2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrins ITGAM/ITGB2 and ITGAX/ITGB2 are receptors for the iC3b fragment of the third complement component and for fibrinogen. Integrin ITGAX/ITGB2 recognizes the sequence G-P-R in fibrinogen alpha-chain. Integrin ITGAM/ITGB2 recognizes P1 and P2 peptides of fibrinogen gamma chain. Integrin ITGAM/ITGB2 is also a receptor for factor X. Integrin ITGAD/ITGB2 is a receptor for ICAM3 and VCAM1. Contributes to natural killer cell cytotoxicity (By similarity). Involved in leukocyte adhesion and transmigration of leukocytes including T-cells and neutrophils (By similarity). Triggers neutrophil transmigration during lung injury through PTK2B/PYK2-mediated activation. [PubMed: 18587400 Integrin ITGAL/ITGB2 in association with ICAM3, contributes to apoptotic neutrophil phagocytosis by macrophages (By similarity In association with alpha subunit ITGAM/CD11b, required for CD177-PRTN3-mediated activation of TNF primed neutrophils (By similarity Alpha-M/beta-2 play a critical role in mast cell development and in immune complex-mediated glomerulonephritis. Mice expressing a null mutation of the alpha-M subunit gene demonstrate increase in neutrophil accumulation, in response to a impaired degranulation and phagocytosis, events that apparently accelerate apoptosis in neutrophils. These mice develop obesity.]
• Protein Sequence: MLGLRPSLLLALAGLFFLGSAVSQECTKYKVSSCRDCIQSGPGCSWCQKLNFTGPGEPDSLRCDTRAQLLLKGCPADDIMDPRSIANPEFDQRGQRKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLNNVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFVNTHPEKLRNPCPNKEKACQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAIMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNMYKRSNEFDYPSVGQLAHKLSESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSDDSSNVVQLIKNAYYKLSSRVFLDHSTLPDTLKVTYDSFCSNGASSIGKSRGDCDGVQINNPVTFQVKVMASECIQEQSFVIRALGFTDTVTVQVRPQCECQCRDQSREQSLCGGKGVMECGICRCESGYIGKNCECQTQGRSSQELERNCRKDNSSIVCSGLGDCICGQCVCHTSDVPNKEIFGQYCECDNVNCERYNSQVCGGSDRGSCNCGKCSCKPGYEGSACQCQRSTTGCLNARLVECSGRGHCQCNRCICDEGYQPPMCEDCPSCGSHCRDNHTSCAECLKFDKGPFEKNCSVQCAGMTLQTIPLKKKPCKERDSEGCWITYTLQQKDGRNIYNIHVEDSLECVKGPNVAAIVGGTVVGVVLIGVLLLVIWKALTHLTDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
24	Pyrrolidone_carboxylic_acid	FLGSAVSQECTKYKV HHHHHHCHHHHCCCC	43.09	-
51	N-linked_Glycosylation	CSWCQKLNFTGPGEP CCHHHHCCCCCCCCC	39.20	-
53	Phosphorylation	WCQKLNFTGPGEPDS HHHHCCCCCCCCCCC	41.20	-
117	N-linked_Glycosylation	PGQAAAFNVTFRRAK CCCCEEEEEEEEECC	27.48	-
192	Glutathionylation	PEKLRNPCPNKEKAC HHHHCCCCCCHHHHC	7.10	24333276
247	Glutathionylation	AIMQVAACPEEIGWR HHHHHHCCCHHHCCC	2.92	24333276
255	N-linked_Glycosylation	PEEIGWRNVTRLLVF CHHHCCCCEEEEEEE	32.76	-
387	Glutathionylation	KVTYDSFCSNGASSI EEEHHHHCCCCCHHC	3.41	24333276
421	Glutathionylation	VKVMASECIQEQSFV EEEEHHHHHHHCCEE	3.45	24333276
502	N-linked_Glycosylation	ERNCRKDNSSIVCSG HHHHCCCCCCEECCC	40.46	-
626	N-linked_Glycosylation	CGSHCRDNHTSCAEC CCCHHCCCCCCHHHH	22.45	-
644	N-linked_Glycosylation	DKGPFEKNCSVQCAG CCCCCCCCCCCEECC	18.99	-
672	Glutathionylation	KERDSEGCWITYTLQ CCCCCCCCEEEEEEE	1.77	24333276
746	Ubiquitination	RFEKEKLKSQWNNDN HHHHHHHHHHHCCCC	52.23	-
747	Phosphorylation	FEKEKLKSQWNNDNP HHHHHHHHHHCCCCC	51.36	-
758	Phosphorylation	NDNPLFKSATTTVMN CCCCCHHHHHEEECC	24.42	21082442
760	Phosphorylation	NPLFKSATTTVMNPK CCCHHHHHEEECCHH	30.05	19060867
761	Phosphorylation	PLFKSATTTVMNPKF CCHHHHHEEECCHHH	19.67	29472430
762	Phosphorylation	LFKSATTTVMNPKFA CHHHHHEEECCHHHC	17.25	29472430
767	Ubiquitination	TTTVMNPKFAES--- HEEECCHHHCCC---	52.80	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ITB2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ITB2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ITB2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
1433B_MOUSE	Ywhab	physical	18239087

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.