ISU1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ISU1_ARATH
• UniProt AC: O49627
• Protein Name: Iron-sulfur cluster assembly protein 1
• Gene Name: ISU1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 167
• Subcellular Localization: Mitochondrion matrix .
• Protein Description: Scaffold protein for the de novo synthesis of iron-sulfur (Fe-S) clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic [2Fe-2S] and [4Fe-4S] proteins. [PubMed: 15507320]
• Protein Sequence: MMLKQAAKKALGLTSRQSTPWSVGILRTYHENVIDHYDNPRNVGSFDKNDPNVGTGLVGAPACGDVMKLQIKVDEKTGQIVDARFKTFGCGSAIASSSVATEWVKGKAMEDVLTIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYKEKRVKTNGAAAAGETTQA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
109	Sulfoxidation	EWVKGKAMEDVLTIK HHHCCCCHHCCEEEC	5.28	25693801

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ISU1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ISU1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ISU1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.