UniProt ID | ISK1_HUMAN | |
---|---|---|
UniProt AC | P00995 | |
Protein Name | Serine protease inhibitor Kazal-type 1 {ECO:0000312|HGNC:HGNC:11244} | |
Gene Name | SPINK1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 79 | |
Subcellular Localization | Secreted . | |
Protein Description | Serine protease inhibitor which exhibits anti-trypsin activity. [PubMed: 7142173 In the pancreas, protects against trypsin-catalyzed premature activation of zymogens (By similarity; In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production.] | |
Protein Sequence | MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | VTGIFLLSALALLSL CCHHHHHHHHHHHHH | 24.31 | 18452278 | |
16 | Phosphorylation | LSALALLSLSGNTGA HHHHHHHHHCCCCCH | 22.72 | 18452278 | |
18 | Phosphorylation | ALALLSLSGNTGADS HHHHHHHCCCCCHHH | 26.99 | 18452278 | |
69 | Phosphorylation | FENRKRQTSILIQKS ECCCCCCEEEEEEEC | 23.05 | 22673903 | |
70 | Phosphorylation | ENRKRQTSILIQKSG CCCCCCEEEEEEECC | 13.68 | 22673903 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ISK1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ISK1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ISK1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ISK1_HUMAN !! |
loading...