dbPTM

ISK1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ISK1_HUMAN
UniProt AC	P00995
Protein Name	Serine protease inhibitor Kazal-type 1 {ECO:0000312\|HGNC:HGNC:11244}
Gene Name	SPINK1
Organism	Homo sapiens (Human).
Sequence Length	79
Subcellular Localization	Secreted .
Protein Description	Serine protease inhibitor which exhibits anti-trypsin activity. [PubMed: 7142173 In the pancreas, protects against trypsin-catalyzed premature activation of zymogens (By similarity; In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production.]
Protein Sequence	MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Phosphorylation	VTGIFLLSALALLSL CCHHHHHHHHHHHHH	24.31	18452278
16	Phosphorylation	LSALALLSLSGNTGA HHHHHHHHHCCCCCH	22.72	18452278
18	Phosphorylation	ALALLSLSGNTGADS HHHHHHHCCCCCHHH	26.99	18452278
69	Phosphorylation	FENRKRQTSILIQKS ECCCCCCEEEEEEEC	23.05	22673903
70	Phosphorylation	ENRKRQTSILIQKSG CCCCCCEEEEEEECC	13.68	22673903

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ISK1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ISK1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ISK1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ISK1_HUMAN !!

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
167800	Pancreatitis, hereditary (PCTT)
608189	Tropical calcific pancreatitis (TCP)
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ISK1_HUMAN

Related Literatures of Post-Translational Modification