UniProt ID | IQCK_HUMAN | |
---|---|---|
UniProt AC | Q8N0W5 | |
Protein Name | IQ domain-containing protein K | |
Gene Name | IQCK | |
Organism | Homo sapiens (Human). | |
Sequence Length | 287 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAAPRQIPSHIVRLKPSCSTDSSFTRTPVPTVSLASRELPVSSWQVTEPSSKNLWEQICKEYEAEQPPFPEGYKVKQEPVITVAPVEEMLFHGFSAEHYFPVSHFTMISRTPCPQDKSETINPKTCSPKEYLETFIFPVLLPGMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSIPFVEERLKQHPRPPIPLSLLLTEEEAALYIQSFWRACVVRCDPEIQELRQWQKKLREAKHIHQQVKIFWAKQEQKVKCKMEDDAVPAAKMKIPSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | AAPRQIPSHIVRLKP CCCCCCCCCEEEECC | 27.72 | - | |
17 | Phosphorylation | HIVRLKPSCSTDSSF CEEEECCCCCCCCCC | 21.07 | 30576142 | |
22 | Phosphorylation | KPSCSTDSSFTRTPV CCCCCCCCCCCCCCC | 27.69 | - | |
23 | Phosphorylation | PSCSTDSSFTRTPVP CCCCCCCCCCCCCCC | 33.19 | 30576142 | |
27 | Phosphorylation | TDSSFTRTPVPTVSL CCCCCCCCCCCEEEE | 26.11 | 22817900 | |
36 | Phosphorylation | VPTVSLASRELPVSS CCEEEEECCCCCCCE | 31.42 | 30576142 | |
42 | Phosphorylation | ASRELPVSSWQVTEP ECCCCCCCEEECCCC | 24.74 | 25693802 | |
43 | Phosphorylation | SRELPVSSWQVTEPS CCCCCCCEEECCCCC | 23.05 | 25693802 | |
47 | Phosphorylation | PVSSWQVTEPSSKNL CCCEEECCCCCCCCH | 27.38 | 25693802 | |
74 | Ubiquitination | PPFPEGYKVKQEPVI CCCCCCCCCCCCCCE | 54.54 | - | |
117 | Ubiquitination | RTPCPQDKSETINPK CCCCCCCCCCCCCCC | 44.97 | - | |
286 | Phosphorylation | AAKMKIPSS------ HHHCCCCCC------ | 52.75 | 23186163 | |
287 | Phosphorylation | AKMKIPSS------- HHCCCCCC------- | 38.60 | 23186163 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IQCK_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IQCK_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IQCK_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of IQCK_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...