UniProt ID | IPYR6_ARATH | |
---|---|---|
UniProt AC | Q9LXC9 | |
Protein Name | Soluble inorganic pyrophosphatase 6, chloroplastic {ECO:0000303|PubMed:15135060} | |
Gene Name | PPA6 {ECO:0000303|PubMed:15135060} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 300 | |
Subcellular Localization | Plastid, chloroplast stroma . | |
Protein Description | ||
Protein Sequence | MAATRVLTAATAVTQTTSCFLAKQAFTLPAKKSCGGFGGLCFSRRALVLKSKRPFSCSAIYNPQVKVQEEGPAESLDYRVFFLDGSGKKVSPWHDIPLTLGDGVFNFIVEIPKESKAKMEVATDEDFTPIKQDTKKGKLRYYPYNINWNYGLLPQTWEDPSHANSEVEGCFGDNDPVDVVEIGETQRKIGDILKIKPLAALAMIDEGELDWKIVAISLDDPKAHLVNDVEDVEKHFPGTLTAIRDWFRDYKIPDGKPANRFGLGDKPANKDYALKIIQETNESWAKLVKRSVDAGDLSLY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MAATRVLTAATAVTQ CCHHHHHHHHHHHHH | 19880383 | ||
11 | Phosphorylation | TRVLTAATAVTQTTS HHHHHHHHHHHHHCH | 19880383 | ||
17 | Phosphorylation | ATAVTQTTSCFLAKQ HHHHHHHCHHHHHHC | 19880383 | ||
86 | Phosphorylation | RVFFLDGSGKKVSPW EEEEECCCCCCCCCC | 30291188 | ||
118 | Acetylation | IPKESKAKMEVATDE ECHHHHCCCEECCCC | 24727099 | ||
119 | Sulfoxidation | PKESKAKMEVATDED CHHHHCCCEECCCCC | 25693801 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IPYR6_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IPYR6_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IPYR6_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of IPYR6_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...