dbPTM

IPYR2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	IPYR2_ARATH
UniProt AC	P21216
Protein Name	Soluble inorganic pyrophosphatase 2 {ECO:0000303\|PubMed:15135060}
Gene Name	PPA2 {ECO:0000303\|PubMed:15135060}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	218
Subcellular Localization	Cytoplasm .
Protein Description
Protein Sequence	MAEIKDEGSAKGYAFPLRNPNVTLNERNFAAFTHRSAAAHPWHDLEIGPEAPTVFNCVVEISKGGKVKYELDKNSGLIKVDRVLYSSIVYPHNYGFIPRTICEDSDPMDVLVLMQEPVLTGSFLRARAIGLMPMIDQGEKDDKIIAVCADDPEFRHYRDIKELPPHRLAEIRRFFEDYKKNENKKVDVEAFLPAQAAIDAIKDSMDLYAAYIKAGLQR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
9	Phosphorylation	AEIKDEGSAKGYAFP CCCCCCCCCCCEEEE	25.43	27545962
205	Sulfoxidation	IDAIKDSMDLYAAYI HHHHHHHHHHHHHHH	6.20	25693801

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of IPYR2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of IPYR2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of IPYR2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of IPYR2_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of IPYR2_ARATH

Related Literatures of Post-Translational Modification