UniProt ID | IPKA_HUMAN | |
---|---|---|
UniProt AC | P61925 | |
Protein Name | cAMP-dependent protein kinase inhibitor alpha | |
Gene Name | PKIA | |
Organism | Homo sapiens (Human). | |
Sequence Length | 76 | |
Subcellular Localization | ||
Protein Description | Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.. | |
Protein Sequence | MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGEAAKSES | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MTDVETTYA ------CCCCHHHHH | 49.07 | 22814378 | |
8 | Phosphorylation | MTDVETTYADFIASG CCCCHHHHHHHHHCC | 16.16 | 1956339 | |
59 | Phosphorylation | GEEDAQRSSTEQSGE CHHHHHHHCHHHHHH | 29.54 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
8 | Y | Phosphorylation | Kinase | EGFR | P00533 | PhosphoELM |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IPKA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IPKA_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GSP1_YEAST | GSP1 | physical | 25437554 | |
XPO1_YEAST | CRM1 | physical | 25437554 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...