IPKA_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IPKA_HUMAN
• UniProt AC: P61925
• Protein Name: cAMP-dependent protein kinase inhibitor alpha
• Gene Name: PKIA
• Organism: Homo sapiens (Human).
• Sequence Length: 76
• Protein Description: Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains..
• Protein Sequence: MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGEAAKSES

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MTDVETTYA ------CCCCHHHHH	49.07	22814378
8	Phosphorylation	MTDVETTYADFIASG CCCCHHHHHHHHHCC	16.16	1956339
59	Phosphorylation	GEEDAQRSSTEQSGE CHHHHHHHCHHHHHH	29.54	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
8	Y	Phosphorylation	Kinase	EGFR	P00533	PhosphoELM

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IPKA_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IPKA_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GSP1_YEAST	GSP1	physical	25437554
XPO1_YEAST	CRM1	physical	25437554

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.