| UniProt ID | INV1_SCHPO | |
|---|---|---|
| UniProt AC | O59852 | |
| Protein Name | Invertase | |
| Gene Name | inv1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 581 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MFLKYILASGICLVSLLSSTNAAPRHLYVKRYPVIYNASNITEVSNSTTVPPPPFVNTTAPNGTCLGNYNEYLPSGYYNATDRPKIHFTPSSGFMNDPNGLVYTGGVYHMFFQYSPKTLTAGEVHWGHTVSKDLIHWENYPIAIYPDEHENGVLSLPFSGSAVVDVHNSSGLFSNDTIPEERIVLIYTDHWTGVAERQAIAYTTDGGYTFKKYSGNPVLDINSLQFRDPKVIWDFDANRWVMIVAMSQNYGIAFYSSYDLIHWTELSVFSTSGYLGLQYECPGMARVPVEGTDEYKWVLFISINPGAPLGGSVVQYFVGDWNGTNFVPDDGQTRFVDLGKDFYASALYHSSSANADVIGVGWASNWQYTNQAPTQVFRSAMTVARKFTLRDVPQNPMTNLTSLIQTPLNVSLLRDETLFTAPVINSSSSLSGSPITLPSNTAFEFNVTLSINYTEGCTTGYCLGRIIIDSDDPYRLQSISVDVDFAASTLVINRAKAQMGWFNSLFTPSFANDIYIYGNVTLYGIVDNGLLELYVNNGEKTYTNDFFFLQGATPGQISFAAFQGVSFNNVTVTPLKTIWNC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 37 | N-linked_Glycosylation | KRYPVIYNASNITEV EECCEEEECCCCEEE | 26.26 | 2187435 | |
| 40 | N-linked_Glycosylation | PVIYNASNITEVSNS CEEEECCCCEEECCC | 42.67 | 2187435 | |
| 46 | N-linked_Glycosylation | SNITEVSNSTTVPPP CCCEEECCCCCCCCC | 48.85 | 2187435 | |
| 57 | N-linked_Glycosylation | VPPPPFVNTTAPNGT CCCCCCCCCCCCCCC | 31.90 | 2187435 | |
| 62 | N-linked_Glycosylation | FVNTTAPNGTCLGNY CCCCCCCCCCCCCCC | 56.81 | 2187435 | |
| 79 | N-linked_Glycosylation | YLPSGYYNATDRPKI CCCCCCCCCCCCCCC | 28.07 | 2187435 | |
| 168 | N-linked_Glycosylation | SAVVDVHNSSGLFSN CEEEEEECCCCCCCC | 37.41 | 2187435 | |
| 175 | N-linked_Glycosylation | NSSGLFSNDTIPEER CCCCCCCCCCCCHHH | 43.01 | 2187435 | |
| 322 | N-linked_Glycosylation | QYFVGDWNGTNFVPD EEECCCCCCCCCCCC | 52.75 | 2187435 | |
| 399 | N-linked_Glycosylation | VPQNPMTNLTSLIQT CCCCCCCCHHHHCCC | 34.76 | 2187435 | |
| 409 | N-linked_Glycosylation | SLIQTPLNVSLLRDE HHCCCCCCHHHCCCC | 23.64 | 2187435 | |
| 425 | N-linked_Glycosylation | LFTAPVINSSSSLSG EEECCEECCCCCCCC | 35.75 | 2187435 | |
| 446 | N-linked_Glycosylation | SNTAFEFNVTLSINY CCCEEEEEEEEEEEE | 20.75 | 2187435 | |
| 452 | N-linked_Glycosylation | FNVTLSINYTEGCTT EEEEEEEEECCCCCC | 34.01 | 2187435 | |
| 519 | N-linked_Glycosylation | NDIYIYGNVTLYGIV CCEEEECCEEEEEEE | 13.46 | 2187435 | |
| 569 | N-linked_Glycosylation | FQGVSFNNVTVTPLK EECCEECCEEEEECE | 28.91 | 2187435 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of INV1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of INV1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of INV1_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of INV1_SCHPO !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
