UniProt ID | INMT_MOUSE | |
---|---|---|
UniProt AC | P40936 | |
Protein Name | Indolethylamine N-methyltransferase | |
Gene Name | Inmt | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 264 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Catalyzes the N-methylation of tryptamine and structurally related compounds (By similarity). Functions as thioether S-methyltransferase and is active with a variety of thioethers and the corresponding selenium and tellurium compounds, including 3-methylthiopropionaldehyde, dimethyl selenide, dimethyl telluride, 2-methylthioethylamine, 2-methylthioethanol, methyl-n-propyl sulfide and diethyl sulfide. Plays an important role in the detoxification of selenium compounds.. | |
Protein Sequence | MEGKVYIGGEDYEKEFTPKDYLTTYYSFHSGPVAEQEIVKFSLQNLYQTFSTGGVGGDVLIDIGSGPTIYQLLSACEVFREIIVTDYTPQNLQELQKWLKKEPGAYDWSSIVQHACELEGDRSRWQEKEAKLRRTVTRVLRCDVTKTPPLGSAQVPLADCVLTFLAMECACPDIDTYRAALRRLAGLLKPGGHLVTLVTLRFQHYMVGPKKFSGVYLEKEVVEKAIQDAGCQVLKCNCVSLSYSEAYCSHDGLCFVVARKGPSA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Succinylation | ----MEGKVYIGGED ----CCCEEEECCCC | 20.68 | 23954790 | |
6 | Phosphorylation | --MEGKVYIGGEDYE --CCCEEEECCCCCC | 9.42 | 20469934 | |
14 | Ubiquitination | IGGEDYEKEFTPKDY ECCCCCCCCCCCHHH | 52.47 | - | |
14 | Succinylation | IGGEDYEKEFTPKDY ECCCCCCCCCCCHHH | 52.47 | - | |
14 | Malonylation | IGGEDYEKEFTPKDY ECCCCCCCCCCCHHH | 52.47 | 26320211 | |
14 | Succinylation | IGGEDYEKEFTPKDY ECCCCCCCCCCCHHH | 52.47 | 23806337 | |
14 | Acetylation | IGGEDYEKEFTPKDY ECCCCCCCCCCCHHH | 52.47 | 23806337 | |
19 | Acetylation | YEKEFTPKDYLTTYY CCCCCCCHHHHEEEE | 56.82 | 23954790 | |
19 | Ubiquitination | YEKEFTPKDYLTTYY CCCCCCCHHHHEEEE | 56.82 | 22790023 | |
30 | Phosphorylation | TTYYSFHSGPVAEQE EEEEEECCCCCCHHH | 42.66 | 23984901 | |
87 | Phosphorylation | REIIVTDYTPQNLQE HHHHCCCCCHHHHHH | 15.79 | 25195567 | |
97 | Acetylation | QNLQELQKWLKKEPG HHHHHHHHHHHHCCC | 68.09 | 23806337 | |
97 | Succinylation | QNLQELQKWLKKEPG HHHHHHHHHHHHCCC | 68.09 | - | |
97 | Ubiquitination | QNLQELQKWLKKEPG HHHHHHHHHHHHCCC | 68.09 | - | |
97 | Succinylation | QNLQELQKWLKKEPG HHHHHHHHHHHHCCC | 68.09 | 23806337 | |
101 | Ubiquitination | ELQKWLKKEPGAYDW HHHHHHHHCCCCCCH | 67.95 | - | |
101 | Malonylation | ELQKWLKKEPGAYDW HHHHHHHHCCCCCCH | 67.95 | 26320211 | |
106 | Phosphorylation | LKKEPGAYDWSSIVQ HHHCCCCCCHHHHHH | 24.70 | 25521595 | |
109 | Phosphorylation | EPGAYDWSSIVQHAC CCCCCCHHHHHHHHH | 13.80 | 25521595 | |
116 | S-palmitoylation | SSIVQHACELEGDRS HHHHHHHHHHCCCHH | 6.02 | 28526873 | |
128 | Succinylation | DRSRWQEKEAKLRRT CHHHHHHHHHHHHHH | 48.12 | 23954790 | |
145 | Phosphorylation | RVLRCDVTKTPPLGS HHHCCCCCCCCCCCC | 18.89 | 23984901 | |
147 | Phosphorylation | LRCDVTKTPPLGSAQ HCCCCCCCCCCCCCC | 22.29 | 23984901 | |
152 | Phosphorylation | TKTPPLGSAQVPLAD CCCCCCCCCCCCHHH | 24.18 | 23984901 | |
163 | Phosphorylation | PLADCVLTFLAMECA CHHHHHHHHHHHHHC | 9.01 | 23984901 | |
210 | Ubiquitination | QHYMVGPKKFSGVYL CCEECCCCCCCCEEE | 61.60 | 27667366 | |
211 | Acetylation | HYMVGPKKFSGVYLE CEECCCCCCCCEEEC | 48.14 | 23806337 | |
211 | Succinylation | HYMVGPKKFSGVYLE CEECCCCCCCCEEEC | 48.14 | - | |
211 | Malonylation | HYMVGPKKFSGVYLE CEECCCCCCCCEEEC | 48.14 | 26320211 | |
211 | Ubiquitination | HYMVGPKKFSGVYLE CEECCCCCCCCEEEC | 48.14 | - | |
213 | Phosphorylation | MVGPKKFSGVYLEKE ECCCCCCCCEEECHH | 35.91 | 29472430 | |
216 | Phosphorylation | PKKFSGVYLEKEVVE CCCCCCEEECHHHHH | 16.81 | 20469934 | |
219 | Ubiquitination | FSGVYLEKEVVEKAI CCCEEECHHHHHHHH | 53.89 | - | |
219 | Acetylation | FSGVYLEKEVVEKAI CCCEEECHHHHHHHH | 53.89 | 23864654 | |
219 | Malonylation | FSGVYLEKEVVEKAI CCCEEECHHHHHHHH | 53.89 | 26320211 | |
224 | Ubiquitination | LEKEVVEKAIQDAGC ECHHHHHHHHHHCCC | 38.90 | - | |
224 | Acetylation | LEKEVVEKAIQDAGC ECHHHHHHHHHHCCC | 38.90 | 23864654 | |
224 | Malonylation | LEKEVVEKAIQDAGC ECHHHHHHHHHHCCC | 38.90 | 26320211 | |
231 | S-nitrosylation | KAIQDAGCQVLKCNC HHHHHCCCCEEEECE | 2.44 | 21278135 | |
231 | S-palmitoylation | KAIQDAGCQVLKCNC HHHHHCCCCEEEECE | 2.44 | 28526873 | |
231 | S-nitrosocysteine | KAIQDAGCQVLKCNC HHHHHCCCCEEEECE | 2.44 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of INMT_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of INMT_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of INMT_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of INMT_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...