dbPTM

INE_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	INE_DROME
UniProt AC	Q9VR07
Protein Name	Sodium- and chloride-dependent GABA transporter ine
Gene Name	ine {ECO:0000312\|FlyBase:FBgn0011603}
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	943
Subcellular Localization	Membrane Multi-pass membrane protein .
Protein Description	Plays a role in neuronal membrane excitation, important for normal response properties of the photoreceptor. Able to control excitability from either neurons or glia cells. Ine negatively regulates neuronal sodium channels. Controls neurotransmitter-mediated signaling pathways associated with the structure of the larval peripheral nerve, ine and eag control perineurial glial growth through partially redundant pathways. Isoform A and isoform B are both functional, although isoform A functions with greater efficiency. Has a role in osmolyte transport within the Malpighian tubule and hindgut..
Protein Sequence	MAENKDVSQVLNTTPDQVVINRAPPTGLAPLRHSQLSDSGAESCYEGDEQARLIRSSSSRAHKFIIIPATPGTPPGSGAVAGPLPFRQTSSTTSLAAMAAALHKQSPLRHTSVRTRPSSEVLQPGQVLANQPTAAVSTSTVTFTIDDCNEEGDAIPAAASVPAPVTMPAISPTPATLTCTTTTTMAGDSVAVSPLSMELKSRLGSHHSSMRSVVSGYLPGLSDSSGNLVGGVSMATSGLQAPNPLYMQPQASLSGSSYHFHELAGNQIYSDVTSVRSLASIGIGSTDGRKLVIRRVPTTANELFDMVNPQTPPPLGVDDDDSYLDMSDETAQLKPRQQHWANKMQFVLACIGYSVGLGNVWRFPYMCYKSGGGVFLVPYCIILFICSIPLLFMELSVGQYTGRGPIGALGQLCPLFKGAGLASVVVSFLMSTYYSVIIGYSIYYFFTSFKTEMPWIDCNNRWNTPDCWVPQRKGINASAPDTSRTPSEEFFENKVLQISGGLEYPGMMRWELFACLICAWLMVYFATWKSIKSSAKVRYFTATFPFVLIIILMVRAVTLDGAAEGLRFFFRPKWSELKNANVWINAASQNFNSLGITFGSMISFASYNKYNNNILRDTVAVSAVNMITSLLVGIFAFSTLGNLALEQNTNVRDVIGDGPGMIFVVYPQAMAKMPYAQLWAVMFFFMLLCLGLNSQFAIVEVVVTSIQDGFPRWIKRHLGYHEIVVLFVCVISCLFGMPNIIQGGIYYFQLMDHYAASVTIMFLAFCQMIAIAWFYGTGRLSKNVKQMTGKAPSFYLRSCWLVLGPCLLFAIWVLSLINYHEPTYHNGRYTYPDWAYGIGWMFASFSLICIPGYAVINFLRSSGDTFWERIRNTLRPNIYECKICGEHHCEHDYPEQEQFMLAQEMATVYKPTNPHLLNLGQKCGYNAMQASPSHAEAGGPCGQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
476	N-linked_Glycosylation	VPQRKGINASAPDTS CCCCCCCCCCCCCCC	36.19	17893096

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of INE_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of INE_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of INE_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of INE_DROME

Related Literatures of Post-Translational Modification

N-linked Glycosylation
Reference	PubMed
"Identification of N-glycosylated proteins from the central nervoussystem of Drosophila melanogaster."; Koles K., Lim J.-M., Aoki K., Porterfield M., Tiemeyer M., Wells L.,Panin V.; Glycobiology 17:1388-1403(2007). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-476, AND MASSSPECTROMETRY.	17893096 [Abstract]