IMP3_MOUSE - dbPTM
IMP3_MOUSE - PTM Information in dbPTM
Basic Information of Protein
UniProt ID IMP3_MOUSE
UniProt AC Q921Y2
Protein Name U3 small nucleolar ribonucleoprotein protein IMP3
Gene Name Imp3
Organism Mus musculus (Mouse).
Sequence Length 184
Subcellular Localization Nucleus, nucleolus.
Protein Description Component of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP). Required for the early cleavages during pre-18S ribosomal RNA processing (By similarity)..
Protein Sequence MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREEYTRYNQLSRAVRELARRLRDLPERDPFRVRASAALLDKLYAMGLVPTRGSLELCDSVSASSFCRRRLPTLLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLDA
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of IMP3_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of IMP3_MOUSE !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of IMP3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of IMP3_MOUSE !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of IMP3_MOUSE !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of IMP3_MOUSE

loading...

Related Literatures of Post-Translational Modification

TOP