| UniProt ID | IMDH1_MOUSE | |
|---|---|---|
| UniProt AC | P50096 | |
| Protein Name | Inosine-5'-monophosphate dehydrogenase 1 {ECO:0000255|HAMAP-Rule:MF_03156} | |
| Gene Name | Impdh1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 514 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth. Could also have a single-stranded nucleic acid-binding activity and could play a role in RNA and/or DNA metabolism. It may also have a role in the development of malignancy and the growth progression of some tumors.. | |
| Protein Sequence | MADYLISGGTGYVPEDGLTAQQLFANADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKIQHGFSGIPITATGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRVELVVAPAGVTLKEANEILQRSKKGKLPIVNDQDELVAIIARTDLKKNRDYPLASKDSHKQLLCGAAVGTREDDKYRLDLLTQAGADVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPVIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGAQSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 126 | Ubiquitination | VVLSPSHTVGDVLEA EEECCCCCHHHHHHH | 30.44 | 27667366 | |
| 160 | Phosphorylation | KLVGIVTSRDIDFLA EEEEEEEECCCHHHH | 19.64 | 21082442 | |
| 195 | Ubiquitination | APAGVTLKEANEILQ ECCCCCHHHHHHHHH | 45.47 | 27667366 | |
| 208 | Ubiquitination | LQRSKKGKLPIVNDQ HHHHHCCCCCCCCCH | 61.03 | - | |
| 233 | Phosphorylation | DLKKNRDYPLASKDS CHHHCCCCCCCCCCC | 9.26 | - | |
| 242 | Ubiquitination | LASKDSHKQLLCGAA CCCCCCCCHHHCCEE | 46.74 | - | |
| 252 | Ubiquitination | LCGAAVGTREDDKYR HCCEEECCCCCHHHH | 25.04 | 27667366 | |
| 253 | Ubiquitination | CGAAVGTREDDKYRL CCEEECCCCCHHHHH | 39.14 | 27667366 | |
| 264 | Phosphorylation | KYRLDLLTQAGADVI HHHHHHHHHCCCCEE | 24.54 | 28059163 | |
| 306 | Phosphorylation | VIGGNVVTAAQAKNL EECCEEECHHHHHCH | 16.40 | - | |
| 341 | Methylation | QEVMACGRPQGTAVY HHHHHCCCCCCCHHH | 21.91 | 24129315 | |
| 355 | Methylation | YKVAEYARRFGVPVI HHHHHHHHHHCCCEE | 33.29 | 24129315 | |
| 411 | Phosphorylation | DGVRLKKYRGMGSLD CCCEEEEECCCCCHH | 15.71 | - | |
| 416 | Phosphorylation | KKYRGMGSLDAMEKS EEECCCCCHHHHHHC | 17.74 | 28833060 | |
| 432 | Phosphorylation | SSQKRYFSEGDKVKI CCCCCCCCCCCCEEE | 31.56 | 22817900 | |
| 485 | Phosphorylation | VLRSMMYSGELKFEK HHHHHHHHCCCEEEE | 14.11 | - | |
| 496 | Phosphorylation | KFEKRTMSAQIEGGV EEEEECCEEEEECCC | 19.19 | 26060331 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IMDH1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IMDH1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IMDH1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of IMDH1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
