IMA4_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IMA4_MOUSE
• UniProt AC: O35344
• Protein Name: Importin subunit alpha-4
• Gene Name: Kpna3
• Organism: Mus musculus (Mouse).
• Sequence Length: 521
• Subcellular Localization: Cytoplasm. Nucleus.
• Protein Description: Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS..
• Protein Sequence: MAENPGLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDVDADFKAQNVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVKCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFINPSIPITFLRNVTWVIVNLCRNKDPPPPMETVQEILPALCVLIYHTDINILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPSLIPEATQGGTYNFDPTANLQTKEFNF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAENPGLEN ------CCCCCCCCC	28.47	-
14	Phosphorylation	LENHRIKSFKNKGRD CCCHHHHHHHCCCCC	58.69	29514104
33	Phosphorylation	RRHRNEVTVELRKNK HHHHCCHHHHHHHCC	1.95	28464351
56	Phosphorylation	RNVPQEESLEDSDVD CCCCCHHHCCCCCCC	2.45	25521595
60	Phosphorylation	QEESLEDSDVDADFK CHHHCCCCCCCHHHH	17.74	24925903
398	Phosphorylation	AISNLTISGRKDQVE HHHCCEECCCHHHHH	27.58	22802335
406	Phosphorylation	GRKDQVEYLVQQNVI CCHHHHHHHHHCCCC	12.89	22802335
484	Phosphorylation	AFEIIDQYFSGDDID HHHHHHHHHCCCCCC	5.94	-
517	Ubiquitination	PTANLQTKEFNF--- CCCCCCCCEECC---	52.52	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of IMA4_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IMA4_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IMA4_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of IMA4_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.