dbPTM

ILL1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ILL1_ARATH
UniProt AC	P54969
Protein Name	IAA-amino acid hydrolase ILR1-like 1 {ECO:0000303\|PubMed:7792599}
Gene Name	ILL1 {ECO:0000303\|PubMed:7792599}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	438
Subcellular Localization	Endoplasmic reticulum lumen .
Protein Description	Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA), including IAA-Ala, IAA-Asn and IAA-Tyr..
Protein Sequence	MALNNFLTFQLLLLLLRVSSESPWIVAGDVSRIPINFLELAKSPEVFDSMVRIRRKIHENPELGYEEFETSKFIRSELDLIGVKYRFPVAITGIIGYIGTGEPPFVALRADMDALPIQEAVEWEHKSKNPGKMHACGHDGHVAMLLGAAKILQQHRQHLQGTVVLIFQPAEEGLSGAKMMREEGALKNVEAIFGIHLSPRTPFGKAASLAGSFMAGAGAFEAVITGKGGHAAIPQHTIDPVVAASSIVLSLQHLVSRETDPSDSKVVTVTKVNGGNAFNVIPDSITIGGTLRAFTGFTQLQERIKEIITKQAAVHRCNASVNLAPNGNQPMPPTVNNMDLYKKFKKVVRDLLGQEAFVEAVPEMGSEDFSYFAETIPGHFSLLGMQDETQGYASSHSPHYRINEDVLPYGAAIHATMAVQYLKDKASKGSVSGFHDEL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
49	Phosphorylation	KSPEVFDSMVRIRRK CCHHHHHHHHHHHHH	14.02	22074104
71	Phosphorylation	GYEEFETSKFIRSEL CHHHHHHHHHHHHHH	20.55	19376835

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ILL1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ILL1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ILL1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ILL1_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ILL1_ARATH

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-71, AND MASSSPECTROMETRY.	19376835 [Abstract]