ILK_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ILK_RAT
• UniProt AC: Q99J82
• Protein Name: Integrin-linked protein kinase
• Gene Name: Ilk
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 452
• Subcellular Localization: Cell junction, focal adhesion . Cell membrane ; Peripheral membrane protein ; Cytoplasmic side . Cell projection, lamellipodium . Cytoplasm, myofibril, sarcomere .
• Protein Description: Receptor-proximal protein kinase regulating integrin-mediated signal transduction. May act as a mediator of inside-out integrin signaling. Focal adhesion protein part of the complex ILK-PINCH. This complex is considered to be one of the convergence points of integrin- and growth factor-signaling pathway. Could be implicated in mediating cell architecture, adhesion to integrin substrates and anchorage-dependent growth in epithelial cells. Phosphorylates beta-1 and beta-3 integrin subunit on serine and threonine residues, but also AKT1 and GSK3B..
• Protein Sequence: MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLAKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQAPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDDIFTQC -------CCHHHHHC	10.62	-
85	Acetylation	GHRDIVQKLLQYKAD CCHHHHHHHHHHHCH	40.03	22902405
172	Phosphorylation	KDTFWKGTTRTRPRN CCCCCCCCCCCCCCC	14.91	23984901
173	Phosphorylation	DTFWKGTTRTRPRNG CCCCCCCCCCCCCCC	38.42	23984901
186	Phosphorylation	NGTLNKHSGIDFKQL CCCCCCCCCCCHHHH	38.77	30181290
209	Acetylation	NHSGELWKGRWQGND CCCCCCCCCEECCCC	51.74	22902405
220	Acetylation	QGNDIVVKVLKVRDW CCCCEEEEEEEECCC	30.84	72530407
232	Phosphorylation	RDWSTRKSRDFNEEC CCCCCCCCCCCCCCC	33.52	23984901
426	Acetylation	PHVCKLMKICMNEDP HHHHHHHHHHHCCCH	43.09	25786129

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ILK_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ILK_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ILK_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of ILK_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.