UniProt ID | ILK_RAT | |
---|---|---|
UniProt AC | Q99J82 | |
Protein Name | Integrin-linked protein kinase | |
Gene Name | Ilk | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 452 | |
Subcellular Localization |
Cell junction, focal adhesion . Cell membrane Peripheral membrane protein Cytoplasmic side . Cell projection, lamellipodium . Cytoplasm, myofibril, sarcomere . |
|
Protein Description | Receptor-proximal protein kinase regulating integrin-mediated signal transduction. May act as a mediator of inside-out integrin signaling. Focal adhesion protein part of the complex ILK-PINCH. This complex is considered to be one of the convergence points of integrin- and growth factor-signaling pathway. Could be implicated in mediating cell architecture, adhesion to integrin substrates and anchorage-dependent growth in epithelial cells. Phosphorylates beta-1 and beta-3 integrin subunit on serine and threonine residues, but also AKT1 and GSK3B.. | |
Protein Sequence | MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLAKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQAPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDDIFTQC -------CCHHHHHC | 10.62 | - | |
85 | Acetylation | GHRDIVQKLLQYKAD CCHHHHHHHHHHHCH | 40.03 | 22902405 | |
172 | Phosphorylation | KDTFWKGTTRTRPRN CCCCCCCCCCCCCCC | 14.91 | 23984901 | |
173 | Phosphorylation | DTFWKGTTRTRPRNG CCCCCCCCCCCCCCC | 38.42 | 23984901 | |
186 | Phosphorylation | NGTLNKHSGIDFKQL CCCCCCCCCCCHHHH | 38.77 | 30181290 | |
209 | Acetylation | NHSGELWKGRWQGND CCCCCCCCCEECCCC | 51.74 | 22902405 | |
220 | Acetylation | QGNDIVVKVLKVRDW CCCCEEEEEEEECCC | 30.84 | 72530407 | |
232 | Phosphorylation | RDWSTRKSRDFNEEC CCCCCCCCCCCCCCC | 33.52 | 23984901 | |
426 | Acetylation | PHVCKLMKICMNEDP HHHHHHHHHHHCCCH | 43.09 | 25786129 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ILK_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ILK_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ILK_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ILK_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...