| UniProt ID | IL9_HUMAN | |
|---|---|---|
| UniProt AC | P15248 | |
| Protein Name | Interleukin-9 | |
| Gene Name | IL9 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 144 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Supports IL-2 independent and IL-4 independent growth of helper T-cells.. | |
| Protein Sequence | MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 19 | Pyrrolidone_carboxylic_acid | LLCSVAGQGCPTLAG HHHHHHCCCCCCHHH | 40.35 | - | |
| 19 | Pyrrolidone_carboxylic_acid | LLCSVAGQGCPTLAG HHHHHHCCCCCCHHH | 40.35 | - | |
| 50 | N-linked_Glycosylation | SKCHCSANVTSCLCL HHCCCCCCCCCEEEC | 22.70 | UniProtKB CARBOHYD | |
| 63 | N-linked_Glycosylation | CLGIPSDNCTRPCFS ECCCCCCCCCCCCHH | 33.14 | UniProtKB CARBOHYD | |
| 78 | N-linked_Glycosylation | ERLSQMTNTTMQTRY HHHHHHCCCCHHHCH | 28.36 | UniProtKB CARBOHYD | |
| 85 | Phosphorylation | NTTMQTRYPLIFSRV CCCHHHCHHHHHCHH | 13.04 | 22817900 | |
| 100 | Acetylation | KKSVEVLKNNKCPYF HHHHHHHHCCCCCCC | 64.75 | 30589485 | |
| 114 | N-linked_Glycosylation | FSCEQPCNQTTAGNA CCCCCCCCCCCHHHH | 49.25 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IL9_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IL9_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IL9_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of IL9_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
