IL36B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IL36B_HUMAN
• UniProt AC: Q9NZH7
• Protein Name: Interleukin-36 beta
• Gene Name: IL36B
• Organism: Homo sapiens (Human).
• Sequence Length: 164
• Subcellular Localization: Secreted .
• Protein Description: Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Stimulates production of interleukin-6 and interleukin-8 in synovial fibrobasts, articular chondrocytes and mature adipocytes. Induces expression of a number of antimicrobial peptides including beta-defensins 4 and 103 as well as a number of matrix metalloproteases. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1, and the production of proinflammatory cytokines such as TNF-alpha, IL-8 and IL-6..
• Protein Sequence: MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKLQGSQDNIGKDTCWKLVGIHTCINLDVRESCFMGTLDQWGIGVGRKKWKSSFQHHHLRKKDKDFSSMRTNIGMPGRM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	QREAAPKSYAIRDSR CHHCCCCCEEEECCC	20.81	25002506
12	Phosphorylation	REAAPKSYAIRDSRQ HHCCCCCEEEECCCE	16.51	25002506
17	Phosphorylation	KSYAIRDSRQMVWVL CCEEEECCCEEEEEE	17.98	22210691
25	Phosphorylation	RQMVWVLSGNSLIAA CEEEEEEECCCEEEE	26.72	24043423
28	Phosphorylation	VWVLSGNSLIAAPLS EEEEECCCEEEECCC	25.36	24043423
35	Phosphorylation	SLIAAPLSRSIKPVT CEEEECCCCCCCCEE	23.95	24043423
37	Phosphorylation	IAAPLSRSIKPVTLH EEECCCCCCCCEEEE	31.43	24043423
51	Phosphorylation	HLIACRDTEFSDKEK EEEEEECCCCCCCCC	21.41	29038488
83	Phosphorylation	AEIQGKPTLQLKLQG EEECCCCEEEEEEEC	30.53	19413330
83 (in isoform 2)	Phosphorylation	-	30.53	19413330
95 (in isoform 2)	Phosphorylation	-	11.04	-
153	Phosphorylation	KKDKDFSSMRTNIGM HHCCCHHHHCCCCCC	16.57	30631047
156	Phosphorylation	KDFSSMRTNIGMPGR CCHHHHCCCCCCCCC	23.65	30631047

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of IL36B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IL36B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IL36B_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of IL36B_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.