UniProt ID | IL21_HUMAN | |
---|---|---|
UniProt AC | Q9HBE4 | |
Protein Name | Interleukin-21 | |
Gene Name | IL21 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 155 | |
Subcellular Localization | Secreted . | |
Protein Description | Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells (By similarity). May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation.. | |
Protein Sequence | MERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
90 | N-linked_Glycosylation | GNNERIINVSIKKLK CCCCEEEEEEHHHHH | 21.07 | UniProtKB CARBOHYD | |
97 | N-linked_Glycosylation | NVSIKKLKRKPPSTN EEEHHHHHCCCCCCC | 68.22 | - | |
102 | Phosphorylation | KLKRKPPSTNAGRRQ HHHCCCCCCCCCCCH | 42.70 | - | |
103 | Phosphorylation | LKRKPPSTNAGRRQK HHCCCCCCCCCCCHH | 34.56 | - | |
117 | Phosphorylation | KHRLTCPSCDSYEKK HCCCCCCCCCCCCCC | 32.47 | 30631047 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IL21_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IL21_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IL21_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DGKA_HUMAN | DGKA | physical | 25241761 | |
AL1A1_HUMAN | ALDH1A1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...