UniProt ID | IL1FA_HUMAN | |
---|---|---|
UniProt AC | Q8WWZ1 | |
Protein Name | Interleukin-1 family member 10 | |
Gene Name | IL1F10 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 152 | |
Subcellular Localization | Secreted. | |
Protein Description | Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2.. | |
Protein Sequence | MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | CSLPMARYYIIKYAD CCCCCCEEEHHEECC | 6.89 | - | |
14 | Phosphorylation | ARYYIIKYADQKALY CEEEHHEECCCCEEE | 12.66 | - | |
105 | Phosphorylation | RFTFFQSSSGSAFRL EEEEEECCCCCEEEE | 28.12 | - | |
106 | Phosphorylation | FTFFQSSSGSAFRLE EEEEECCCCCEEEEE | 41.85 | - | |
108 | Phosphorylation | FFQSSSGSAFRLEAA EEECCCCCEEEEEEE | 26.61 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IL1FA_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IL1FA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IL1FA_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of IL1FA_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...