dbPTM

IL17F_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	IL17F_HUMAN
UniProt AC	Q96PD4
Protein Name	Interleukin-17F
Gene Name	IL17F
Organism	Homo sapiens (Human).
Sequence Length	163
Subcellular Localization	Secreted.
Protein Description	Ligand for IL17RA and IL17RC. [PubMed: 17911633 The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC]
Protein Sequence	MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTVKTLHGP ------CCCCCCCHH	30.61	28509920
5	Phosphorylation	---MTVKTLHGPAMV ---CCCCCCCHHHHH	21.46	28509920
83	N-linked_Glycosylation	SRSTSPWNYTVTWDP CCCCCCCEEEEEECC	26.44	19838198
117	Phosphorylation	AQGKEDISMNSVPIQ CCCCCCCCCCCCEEC	25.00	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of IL17F_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of IL17F_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of IL17F_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of IL17F_HUMAN !!

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
613956	Candidiasis, familial, 6 (CANDF6)
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of IL17F_HUMAN

Related Literatures of Post-Translational Modification

N-linked Glycosylation
Reference	PubMed
"Structural basis of receptor sharing by interleukin 17 cytokines."; Ely L.K., Fischer S., Garcia K.C.; Nat. Immunol. 10:1245-1251(2009). Cited for: X-RAY CRYSTALLOGRAPHY (3.3 ANGSTROMS) OF 31-163 IN COMPLEX WITH IL17R,GLYCOSYLATION AT ASN-83, SUBUNIT, AND DISULFIDE BONDS.	19838198 [Abstract]