UniProt ID | IL17B_HUMAN | |
---|---|---|
UniProt AC | Q9UHF5 | |
Protein Name | Interleukin-17B | |
Gene Name | IL17B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 180 | |
Subcellular Localization | Secreted. | |
Protein Description | Stimulates the release of tumor necrosis factor alpha and IL-1-beta from the monocytic cell line THP-1.. | |
Protein Sequence | MDWPHNLLFLLTISIFLGLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
75 | N-linked_Glycosylation | EMVAQLRNSSELAQR HHHHHHHCCHHHHHH | 59.48 | UniProtKB CARBOHYD | |
137 | Phosphorylation | FTMQEDRSMVSVPVF CCCCCCHHCCCCCCC | 35.54 | 29083192 | |
140 | Phosphorylation | QEDRSMVSVPVFSQV CCCHHCCCCCCCCCC | 16.44 | 29083192 | |
145 | Phosphorylation | MVSVPVFSQVPVRRR CCCCCCCCCCCCCCC | 30.42 | 29083192 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IL17B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IL17B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IL17B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of IL17B_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...