UniProt ID | IKBP1_HUMAN | |
---|---|---|
UniProt AC | Q5VVH5 | |
Protein Name | Interleukin-1 receptor-associated kinase 1-binding protein 1 | |
Gene Name | IRAK1BP1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 260 | |
Subcellular Localization | Cytoplasm. Nucleus. | |
Protein Description | Component of the IRAK1-dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. Acts by enhancing RELA transcriptional activity (By similarity).. | |
Protein Sequence | MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSEVSAGPDRAQVVVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVENAWRKAQEVCNLVGQTLGKPLLIKEEETKEWEGQIDDHQSSRLSSSLTVQQKIKSATIHAASKVFITFEVKGKEKRKKHL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Ubiquitination | ---MSLQKTPPTRVF ---CCCCCCCCCEEE | 69.19 | - | |
56 | Phosphorylation | ATREVQVSGTSEVSA CEEEEEECCCCEECC | 21.18 | - | |
62 | Phosphorylation | VSGTSEVSAGPDRAQ ECCCCEECCCCCCEE | 24.37 | - | |
122 | Phosphorylation | FRRVENAYHMEAEVC HHHHHHHHCCCEEEE | 17.18 | - | |
235 | Phosphorylation | TVQQKIKSATIHAAS CHHHHHHHCHHEECC | 33.83 | - | |
237 | Phosphorylation | QQKIKSATIHAASKV HHHHHHCHHEECCEE | 22.01 | - | |
242 | Phosphorylation | SATIHAASKVFITFE HCHHEECCEEEEEEE | 30.09 | - | |
247 | Phosphorylation | AASKVFITFEVKGKE ECCEEEEEEEECCHH | 11.41 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IKBP1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
56 | S | Phosphorylation |
| - |
62 | S | Phosphorylation |
| - |
235 | S | Phosphorylation |
| - |
237 | T | Phosphorylation |
| - |
242 | S | Phosphorylation |
| - |
247 | T | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IKBP1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of IKBP1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...