IKBB_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IKBB_MOUSE
• UniProt AC: Q60778
• Protein Name: NF-kappa-B inhibitor beta
• Gene Name: Nfkbib
• Organism: Mus musculus (Mouse).
• Sequence Length: 359
• Subcellular Localization: Cytoplasm. Nucleus.
• Protein Description: Inhibits NF-kappa-B by complexing with and trapping it in the cytoplasm. However, the unphosphorylated form resynthesized after cell stimulation is able to bind NF-kappa-B allowing its transport to the nucleus and protecting it to further NFKBIA-dependent inactivation. Association with inhibitor kappa B-interacting NKIRAS1 and NKIRAS2 prevent its phosphorylation rendering it more resistant to degradation, explaining its slower degradation..
• Protein Sequence: MAGVACLGKTADADEWCDSGLGSLGPDAAAPGGPGLGAELGPELSWAPLVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHTALHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPILARLLRAHGAPEPEDEDDKLSPCSSSGSDSDSDNRDEGDEYDDIVVHSGRSQNRQPPSPASKPLPDDPNPA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
19	Phosphorylation	DADEWCDSGLGSLGP CHHHHHHCCCHHCCC	32.55	10497169
23	Phosphorylation	WCDSGLGSLGPDAAA HHHCCCHHCCCCCCC	34.88	10497169
313	Phosphorylation	DKLSPCSSSGSDSDS CCCCCCCCCCCCCCC	45.49	-
318	Phosphorylation	CSSSGSDSDSDNRDE CCCCCCCCCCCCCCC	40.48	25338131
339	Phosphorylation	IVVHSGRSQNRQPPS EEEECCCCCCCCCCC	35.02	23984901
346	Phosphorylation	SQNRQPPSPASKPLP CCCCCCCCCCCCCCC	39.52	25521595
349	Phosphorylation	RQPPSPASKPLPDDP CCCCCCCCCCCCCCC	37.88	25266776

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
19	S	Phosphorylation	Kinase	RPS6KA1	P18653	Uniprot
23	S	Phosphorylation	Kinase	RPS6KA1	P18653	Uniprot
-	K	Ubiquitination	E3 ubiquitin ligase	Btrc	Q3ULA2	PMID:22199232
-	K	Ubiquitination	E3 ubiquitin ligase	Skp2	Q9Z0Z3	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IKBB_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IKBB_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of IKBB_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.