UniProt ID | IGLL1_HUMAN | |
---|---|---|
UniProt AC | P15814 | |
Protein Name | Immunoglobulin lambda-like polypeptide 1 | |
Gene Name | IGLL1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 213 | |
Subcellular Localization | Secreted . | |
Protein Description | Critical for B-cell development.. | |
Protein Sequence | MRPGTGQGGLEAPGEPGPNLRQRWPLLLLGLAVVTHGLLRPTAASQSRALGPGAPGGSSRSSLRSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPAECS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
58 | Phosphorylation | GPGAPGGSSRSSLRS CCCCCCCCCHHHHHH | 28.61 | 23401153 | |
59 | Phosphorylation | PGAPGGSSRSSLRSR CCCCCCCCHHHHHHH | 39.18 | 23401153 | |
62 | Phosphorylation | PGGSSRSSLRSRWGR CCCCCHHHHHHHHHH | 27.05 | 24850871 | |
76 | Phosphorylation | RFLLQRGSWTGPRCW HHHHHCCCCCCCCCC | 24.53 | 23401153 | |
93 | Phosphorylation | GFQSKHNSVTHVFGS CCCCCCCCCEEEECC | 28.28 | 23401153 | |
95 | O-linked_Glycosylation | QSKHNSVTHVFGSGT CCCCCCCEEEECCCC | 16.49 | OGP | |
102 | O-linked_Glycosylation | THVFGSGTQLTVLSQ EEEECCCCEEEEEEC | 23.31 | OGP | |
105 | O-linked_Glycosylation | FGSGTQLTVLSQPKA ECCCCEEEEEECCCC | 15.02 | OGP | |
113 | O-linked_Glycosylation | VLSQPKATPSVTLFP EEECCCCCCCEEEEC | 23.40 | OGP | |
117 | O-linked_Glycosylation | PKATPSVTLFPPSSE CCCCCCEEEECCCHH | 27.33 | OGP | |
154 | Phosphorylation | VTWKADGTPITQGVE EEEECCCCCCCCEEE | 16.44 | 22210691 | |
172 | Ubiquitination | PSKQSNNKYAASSYL CCCCCCCCEECHHHC | 40.28 | 21906983 | |
173 | Phosphorylation | SKQSNNKYAASSYLS CCCCCCCEECHHHCC | 14.99 | 23836654 | |
176 | Phosphorylation | SNNKYAASSYLSLTP CCCCEECHHHCCCCH | 16.02 | 20068231 | |
177 | Phosphorylation | NNKYAASSYLSLTPE CCCEECHHHCCCCHH | 25.93 | 20068231 | |
178 | Phosphorylation | NKYAASSYLSLTPEQ CCEECHHHCCCCHHH | 9.60 | 20068231 | |
180 | Phosphorylation | YAASSYLSLTPEQWR EECHHHCCCCHHHHH | 23.20 | 20068231 | |
182 | Phosphorylation | ASSYLSLTPEQWRSR CHHHCCCCHHHHHHC | 22.77 | 20068231 | |
188 | Phosphorylation | LTPEQWRSRRSYSCQ CCHHHHHHCCCEEEE | 29.14 | - | |
191 | Phosphorylation | EQWRSRRSYSCQVMH HHHHHCCCEEEEEEE | 21.93 | - | |
192 | Phosphorylation | QWRSRRSYSCQVMHE HHHHCCCEEEEEEEC | 16.20 | - | |
193 | O-linked_Glycosylation | WRSRRSYSCQVMHEG HHHCCCEEEEEEECC | 10.18 | OGP |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IGLL1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IGLL1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IGLL1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of IGLL1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
613500 | Agammaglobulinemia 2, autosomal recessive (AGM2) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...