| UniProt ID | IFM2_HUMAN | |
|---|---|---|
| UniProt AC | Q01629 | |
| Protein Name | Interferon-induced transmembrane protein 2 | |
| Gene Name | IFITM2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 132 | |
| Subcellular Localization |
Cell membrane Single-pass membrane protein . |
|
| Protein Description | IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronavirus (SARS-CoV), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1) and vesicular stomatitis virus (VSV). Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry, SARS-CoV S protein-mediated viral entry and VSV G protein-mediated viral entry. Induces cell cycle arrest and mediates apoptosis by caspase activation and in p53-independent manner.. | |
| Protein Sequence | MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWSLFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILLIIIPVLVVQAQR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MNHIVQTF -------CCCCEECC | 8.11 | 20068231 | |
| 7 | Phosphorylation | -MNHIVQTFSPVNSG -CCCCEECCCCCCCC | 18.39 | 22199227 | |
| 9 | Phosphorylation | NHIVQTFSPVNSGQP CCCEECCCCCCCCCC | 31.18 | 25159151 | |
| 13 | Phosphorylation | QTFSPVNSGQPPNYE ECCCCCCCCCCCCHH | 38.75 | 22199227 | |
| 19 | Phosphorylation | NSGQPPNYEMLKEEQ CCCCCCCHHHCHHHH | 14.43 | 27259358 | |
| 51 | Phosphorylation | VIHIRSETSVPDHVV EEEEECCCCCCCHHH | 35.95 | - | |
| 70 | S-palmitoylation | NTLFMNTCCLGFIAF HHHHHHHHHHHHHHH | 1.21 | 30723923 | |
| 71 | S-palmitoylation | TLFMNTCCLGFIAFA HHHHHHHHHHHHHHH | 3.81 | 30723923 | |
| 87 | Ubiquitination | SVKSRDRKMVGDVTG HCCCCCCCCCCCCCH | 42.07 | 27667366 | |
| 87 | Ubiquitination | SVKSRDRKMVGDVTG HCCCCCCCCCCCCCH | 42.07 | 21890473 | |
| 93 | Phosphorylation | RKMVGDVTGAQAYAS CCCCCCCCHHHHHHH | 31.38 | 28152594 | |
| 98 | Phosphorylation | DVTGAQAYASTAKCL CCCHHHHHHHHHHHH | 6.76 | 28152594 | |
| 100 | Phosphorylation | TGAQAYASTAKCLNI CHHHHHHHHHHHHHH | 19.07 | 28152594 | |
| 101 | Phosphorylation | GAQAYASTAKCLNIW HHHHHHHHHHHHHHH | 23.20 | 28152594 | |
| 104 | S-palmitoylation | AYASTAKCLNIWALI HHHHHHHHHHHHHHH | 3.05 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IFM2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IFM2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IFM2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of IFM2_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
