| UniProt ID | IFM1_HUMAN | |
|---|---|---|
| UniProt AC | P13164 | |
| Protein Name | Interferon-induced transmembrane protein 1 | |
| Gene Name | IFITM1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 125 | |
| Subcellular Localization |
Cell membrane Single-pass membrane protein . |
|
| Protein Description | IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronavirus (SARS-CoV), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1) and hepatitis C virus (HCV). Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry and SARS-CoV S protein-mediated viral entry. Also implicated in cell adhesion and control of cell growth and migration. Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK activation or by arresting cell growth in G1 phase in a p53-dependent manner. Acts as a positive regulator of osteoblast differentiation.. | |
| Protein Sequence | MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Ubiquitination | -----MHKEEHEVAV -----CCCCCCCEEE | 64.60 | - | |
| 16 | Phosphorylation | AVLGPPPSTILPRST EECCCCCCCCCCCCC | 33.58 | 30108239 | |
| 17 | Phosphorylation | VLGPPPSTILPRSTV ECCCCCCCCCCCCCE | 32.10 | 30108239 | |
| 50 | S-palmitoylation | NTLFLNWCCLGFIAF HHHHHHHHHHHHHHH | 1.02 | 29575903 | |
| 51 | S-palmitoylation | TLFLNWCCLGFIAFA HHHHHHHHHHHHHHH | 2.92 | 29575903 | |
| 67 | Ubiquitination | SVKSRDRKMVGDVTG HHHCCCCCHHCCCCH | 42.07 | 21906983 | |
| 67 | Ubiquitination | SVKSRDRKMVGDVTG HHHCCCCCHHCCCCH | 42.07 | 21890473 | |
| 73 | Phosphorylation | RKMVGDVTGAQAYAS CCHHCCCCHHHHHHH | 31.38 | 28152594 | |
| 78 | Phosphorylation | DVTGAQAYASTAKCL CCCHHHHHHHHHHHH | 6.76 | 28152594 | |
| 80 | Phosphorylation | TGAQAYASTAKCLNI CHHHHHHHHHHHHHH | 19.07 | 28152594 | |
| 81 | Phosphorylation | GAQAYASTAKCLNIW HHHHHHHHHHHHHHH | 23.20 | 28152594 | |
| 84 | S-palmitoylation | AYASTAKCLNIWALI HHHHHHHHHHHHHHH | 3.05 | - | |
| 122 | Ubiquitination | MLQIIQEKRGY---- HHHHHHHHCCC---- | 34.45 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IFM1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IFM1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IFM1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of IFM1_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
