| UniProt ID | IFFO2_MOUSE | |
|---|---|---|
| UniProt AC | Q8R2V2 | |
| Protein Name | Intermediate filament family orphan 2 | |
| Gene Name | Iffo2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 512 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MVNSLLFGEMALAFGCPPGGGGCAGGGGGGGAGPGPSPVTAALRDDLGSNIHLLKGLNVRFRCFLAKVHELERRNRLLEKQLEQQQSERDRRLRYKTFSREQAVQTGPELLRPSAAGSGQALGAATGVNANAVALGGLPPGGGSHPQHYGRLPGTIWSYTQVRRTGGGGVETVQGPGVSWVHPDGVGVQIDTITPEIRALYNVLAKVKRERDEYKRRWEEELAKRMNLQTMVDTLQEAAQEAEAIQEEMNEKIERLKAELVVFKGLMSDPMTDLDTKIQEKAMKVDMDICRRIDITAKLCDVAQQRNSEDVSKIFQVVPKKKDRKVASDEDISEQDGEVNRFSDEEVGSMNITDEMKRMFNQLRETFDFDDDCDSLTWEENEDTLLLWEDFTNCNPTIDLQGEQEENLGNLIHETESFFKTRDKEYQETIGQIELELATAKSDMNRHLHEYMEMCSMKRGLDVQMETCRRLIKGSADRNSPSPSSVASSDSGSTDEIQEDLEREADVEPMVS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MVNSLLFGEMA ----CCCCHHHHCHH | 18.29 | 26239621 | |
| 37 | Phosphorylation | GGAGPGPSPVTAALR CCCCCCCCHHHHHHH | 37.61 | 26239621 | |
| 277 | Acetylation | PMTDLDTKIQEKAMK CCCCCCHHHHHHHHC | 41.90 | 19852719 | |
| 281 | Acetylation | LDTKIQEKAMKVDMD CCHHHHHHHHCCCHH | 37.09 | 19852727 | |
| 328 | Phosphorylation | KKDRKVASDEDISEQ CCCCCCCCCCCCHHH | 44.51 | 19367708 | |
| 480 | Phosphorylation | KGSADRNSPSPSSVA HCCCCCCCCCHHHHC | 27.87 | 25293948 | |
| 482 | Phosphorylation | SADRNSPSPSSVASS CCCCCCCCHHHHCCC | 36.92 | 25293948 | |
| 484 | Phosphorylation | DRNSPSPSSVASSDS CCCCCCHHHHCCCCC | 41.61 | 25293948 | |
| 485 | Phosphorylation | RNSPSPSSVASSDSG CCCCCHHHHCCCCCC | 25.70 | 25293948 | |
| 488 | Phosphorylation | PSPSSVASSDSGSTD CCHHHHCCCCCCCHH | 32.30 | 25293948 | |
| 489 | Phosphorylation | SPSSVASSDSGSTDE CHHHHCCCCCCCHHH | 26.51 | 25293948 | |
| 491 | Phosphorylation | SSVASSDSGSTDEIQ HHHCCCCCCCHHHHH | 36.27 | 25293948 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IFFO2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IFFO2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IFFO2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of IFFO2_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
