UniProt ID | IFFO2_MOUSE | |
---|---|---|
UniProt AC | Q8R2V2 | |
Protein Name | Intermediate filament family orphan 2 | |
Gene Name | Iffo2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 512 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MVNSLLFGEMALAFGCPPGGGGCAGGGGGGGAGPGPSPVTAALRDDLGSNIHLLKGLNVRFRCFLAKVHELERRNRLLEKQLEQQQSERDRRLRYKTFSREQAVQTGPELLRPSAAGSGQALGAATGVNANAVALGGLPPGGGSHPQHYGRLPGTIWSYTQVRRTGGGGVETVQGPGVSWVHPDGVGVQIDTITPEIRALYNVLAKVKRERDEYKRRWEEELAKRMNLQTMVDTLQEAAQEAEAIQEEMNEKIERLKAELVVFKGLMSDPMTDLDTKIQEKAMKVDMDICRRIDITAKLCDVAQQRNSEDVSKIFQVVPKKKDRKVASDEDISEQDGEVNRFSDEEVGSMNITDEMKRMFNQLRETFDFDDDCDSLTWEENEDTLLLWEDFTNCNPTIDLQGEQEENLGNLIHETESFFKTRDKEYQETIGQIELELATAKSDMNRHLHEYMEMCSMKRGLDVQMETCRRLIKGSADRNSPSPSSVASSDSGSTDEIQEDLEREADVEPMVS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MVNSLLFGEMA ----CCCCHHHHCHH | 18.29 | 26239621 | |
37 | Phosphorylation | GGAGPGPSPVTAALR CCCCCCCCHHHHHHH | 37.61 | 26239621 | |
277 | Acetylation | PMTDLDTKIQEKAMK CCCCCCHHHHHHHHC | 41.90 | 19852719 | |
281 | Acetylation | LDTKIQEKAMKVDMD CCHHHHHHHHCCCHH | 37.09 | 19852727 | |
328 | Phosphorylation | KKDRKVASDEDISEQ CCCCCCCCCCCCHHH | 44.51 | 19367708 | |
480 | Phosphorylation | KGSADRNSPSPSSVA HCCCCCCCCCHHHHC | 27.87 | 25293948 | |
482 | Phosphorylation | SADRNSPSPSSVASS CCCCCCCCHHHHCCC | 36.92 | 25293948 | |
484 | Phosphorylation | DRNSPSPSSVASSDS CCCCCCHHHHCCCCC | 41.61 | 25293948 | |
485 | Phosphorylation | RNSPSPSSVASSDSG CCCCCHHHHCCCCCC | 25.70 | 25293948 | |
488 | Phosphorylation | PSPSSVASSDSGSTD CCHHHHCCCCCCCHH | 32.30 | 25293948 | |
489 | Phosphorylation | SPSSVASSDSGSTDE CHHHHCCCCCCCHHH | 26.51 | 25293948 | |
491 | Phosphorylation | SSVASSDSGSTDEIQ HHHCCCCCCCHHHHH | 36.27 | 25293948 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IFFO2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IFFO2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IFFO2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of IFFO2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...