UniProt ID | IFFO2_HUMAN | |
---|---|---|
UniProt AC | Q5TF58 | |
Protein Name | Intermediate filament family orphan 2 | |
Gene Name | IFFO2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 517 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MVNSLLFGEMALAFGCPPGGGGGGCPGGGGGGGGAGPGPSPVTAALRDDLGSNIHLLKGLNVRFRCFLAKVHELERRNRLLEKQLEQQQSERERRLRYKTFSREQAVQTGPELLRPPAPGGGHGLSSGAAAGANANAVALGGLPPGGGSHPQHYGRLPGTIWSYTQVRRTGGGGVETVQGPGVSWVHPDGVGVQIDTITPEIRALYNVLAKVKRERDEYKRRWEEELAKRMNLQTMVDTLQEAAQEADAIQEEMNEKIERLKAELVVFKGLMSDPMTDLDTKIQEKAMKVDMDICRRIDITAKLCDVAQQRNSEDVSKIFQVVPKKKERKVASDDDISEQDGEVNRFSDDEVGSMNITDEMKRMFNQLRETFDFDDDCDSLTWEENEDTLLLWEDFTNCNPTIDLQGEQEENLGNLIHETESFFKTRDKEYQETIGQIELELATAKSDMNRHLHEYMEMCSMKRGLDVQMETCRRLIKGSADRNSPSPSSVASSDSGSTDEIQDEFEREADVEPMVS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
58 | Ubiquitination | GSNIHLLKGLNVRFR CCCCHHCCCCCHHHH | 68.65 | 21890473 | |
70 | Ubiquitination | RFRCFLAKVHELERR HHHHHHHHHHHHHHH | 46.39 | - | |
83 | Ubiquitination | RRNRLLEKQLEQQQS HHHHHHHHHHHHHHH | 61.22 | 21906983 | |
98 | Phosphorylation | ERERRLRYKTFSREQ HHHHHHHHHHHCHHH | 20.97 | 26074081 | |
99 | Ubiquitination | RERRLRYKTFSREQA HHHHHHHHHHCHHHH | 36.34 | - | |
100 | Phosphorylation | ERRLRYKTFSREQAV HHHHHHHHHCHHHHH | 20.22 | 26074081 | |
102 | Phosphorylation | RLRYKTFSREQAVQT HHHHHHHCHHHHHHH | 39.89 | 26074081 | |
199 | Phosphorylation | GVQIDTITPEIRALY CEECCCCCHHHHHHH | 19.57 | 24719451 | |
211 | Ubiquitination | ALYNVLAKVKRERDE HHHHHHHHHHHHHHH | 44.09 | 21890473 | |
213 | Ubiquitination | YNVLAKVKRERDEYK HHHHHHHHHHHHHHH | 48.08 | - | |
286 | Ubiquitination | LDTKIQEKAMKVDMD CCHHHHHHHHCCCHH | 37.09 | 27667366 | |
289 | Ubiquitination | KIQEKAMKVDMDICR HHHHHHHCCCHHHHH | 39.69 | - | |
301 | Phosphorylation | ICRRIDITAKLCDVA HHHHCHHHHHHHHHH | 17.62 | - | |
303 | Ubiquitination | RRIDITAKLCDVAQQ HHCHHHHHHHHHHHH | 40.78 | - | |
318 | Ubiquitination | RNSEDVSKIFQVVPK CCCCCHHHHHHHCCC | 47.60 | 21906983 | |
325 | Ubiquitination | KIFQVVPKKKERKVA HHHHHCCCHHCCCCC | 65.94 | 27667366 | |
330 | Ubiquitination | VPKKKERKVASDDDI CCCHHCCCCCCCCCC | 43.15 | 21906983 | |
333 | Phosphorylation | KKERKVASDDDISEQ HHCCCCCCCCCCHHC | 44.55 | 28961369 | |
338 | Phosphorylation | VASDDDISEQDGEVN CCCCCCCHHCCCCCC | 35.88 | 32142685 | |
348 | Phosphorylation | DGEVNRFSDDEVGSM CCCCCCCCCCCCCCC | 40.70 | 32142685 | |
354 | Phosphorylation | FSDDEVGSMNITDEM CCCCCCCCCCCHHHH | 17.52 | 28348404 | |
358 | Phosphorylation | EVGSMNITDEMKRMF CCCCCCCHHHHHHHH | 22.39 | 26471730 | |
431 | Phosphorylation | FKTRDKEYQETIGQI HHHCCHHHHHHHHHH | 19.86 | 27642862 | |
434 | Phosphorylation | RDKEYQETIGQIELE CCHHHHHHHHHHHHH | 18.19 | 30622161 | |
444 | Phosphorylation | QIELELATAKSDMNR HHHHHHHHHHHHHHH | 47.44 | 30622161 | |
446 | Ubiquitination | ELELATAKSDMNRHL HHHHHHHHHHHHHHH | 42.51 | 21890473 | |
447 | Phosphorylation | LELATAKSDMNRHLH HHHHHHHHHHHHHHH | 39.36 | 30622161 | |
456 | Phosphorylation | MNRHLHEYMEMCSMK HHHHHHHHHHHHHHH | 6.39 | - | |
461 | Phosphorylation | HEYMEMCSMKRGLDV HHHHHHHHHHCCCCH | 26.48 | - | |
463 | Ubiquitination | YMEMCSMKRGLDVQM HHHHHHHHCCCCHHH | 27.33 | - | |
480 | Phosphorylation | CRRLIKGSADRNSPS HHHHHHCCCCCCCCC | 23.22 | 22210691 | |
485 | Phosphorylation | KGSADRNSPSPSSVA HCCCCCCCCCHHHHC | 27.87 | 22210691 | |
487 | Phosphorylation | SADRNSPSPSSVASS CCCCCCCCHHHHCCC | 36.92 | 22210691 | |
489 | Phosphorylation | DRNSPSPSSVASSDS CCCCCCHHHHCCCCC | 41.61 | 27794612 | |
490 | Phosphorylation | RNSPSPSSVASSDSG CCCCCHHHHCCCCCC | 25.70 | 27794612 | |
493 | Phosphorylation | PSPSSVASSDSGSTD CCHHHHCCCCCCCCH | 32.30 | 27794612 | |
494 | Phosphorylation | SPSSVASSDSGSTDE CHHHHCCCCCCCCHH | 26.51 | 27794612 | |
496 | Phosphorylation | SSVASSDSGSTDEIQ HHHCCCCCCCCHHHH | 36.27 | 27794612 | |
498 | Phosphorylation | VASSDSGSTDEIQDE HCCCCCCCCHHHHHH | 36.32 | 22468782 | |
499 | Phosphorylation | ASSDSGSTDEIQDEF CCCCCCCCHHHHHHH | 40.97 | 27794612 | |
517 | Phosphorylation | ADVEPMVS------- HCCCCCCC------- | 28.40 | 33259812 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IFFO2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IFFO2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IFFO2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of IFFO2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...