UniProt ID | IF6_DROME | |
---|---|---|
UniProt AC | P56538 | |
Protein Name | Eukaryotic translation initiation factor 6 {ECO:0000255|HAMAP-Rule:MF_03132} | |
Gene Name | eIF6 {ECO:0000255|HAMAP-Rule:MF_03132} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 245 | |
Subcellular Localization | Cytoplasm . Nucleus, nucleolus . Shuttles between cytoplasm and nucleus/nucleolus. | |
Protein Description | Binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit to form the 80S initiation complex in the cytoplasm. May also be involved in ribosome biogenesis.. | |
Protein Sequence | MALRVQFENNDDIGVFTKLTNTYCLVAIGGSETFYSAFEAELGDTIPVVHANVGGCRIIGRLTVGNRNGLLVPNSTTDEELQHLRNSLPDAVKIYRVEERLSALGNVIACNDYVALVHPDLDKETEEIIADVLKVEVFRQTIADNSLVGSYAVLSNQGGMVHPKTSIQDQDELSSLLQVPLVAGTVNRGSEVLAAGMVVNDWLSFVGMNTTATEISVIESVFKLNQAQPATVTTKLRAALIEDMS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
93 | Acetylation | NSLPDAVKIYRVEER HCCCCHHHHEEHHHH | 35.42 | 21791702 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IF6_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IF6_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IF6_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of IF6_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...