dbPTM

IF5_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	IF5_RAT
UniProt AC	Q07205
Protein Name	Eukaryotic translation initiation factor 5
Gene Name	Eif5
Organism	Rattus norvegicus (Rat).
Sequence Length	429
Subcellular Localization
Protein Description	Catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex (80S.mRNA.Met-tRNA[F])..
Protein Sequence	MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDIGTGKKEKEKKNRKGKDKENGSVSTSETPPPPPPNEISPPHAVEEEEDDDWGEDTTEEAQRRRMDEISDHAKGLTLSDDLERTVEERVNILFDFVKKKKEEGIIDSSDKDIVAEAERLDVKAMGPLVLTEVLFDEKIREQIKKYRRHFLRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKTASVPKVETVKSDNKDDDIDIDAI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSVNVNRSV ------CCCCCCCHH	23.54	25575281
8	Phosphorylation	MSVNVNRSVSDQFYR CCCCCCCHHHHHHHH	22.29	28432305
10	Phosphorylation	VNVNRSVSDQFYRYK CCCCCHHHHHHHHHC	27.26	27097102
14	Phosphorylation	RSVSDQFYRYKMPRL CHHHHHHHHHCCCCE	13.85	28689409
16	Phosphorylation	VSDQFYRYKMPRLIA HHHHHHHHCCCCEEE	10.56	25575281
24	Acetylation	KMPRLIAKVEGKGNG CCCCEEEEEECCCCC	33.55	22902405
28	Acetylation	LIAKVEGKGNGIKTV EEEEEECCCCCEEEE	35.38	22902405
149	Phosphorylation	LKNPPENSDIGTGKK HCCCCCCCCCCCCHH	29.01	30181290
153	Phosphorylation	PENSDIGTGKKEKEK CCCCCCCCCHHHHHH	46.27	29779826
174	Phosphorylation	DKENGSVSTSETPPP CCCCCCCCCCCCCCC	28.10	11861906
176	Phosphorylation	ENGSVSTSETPPPPP CCCCCCCCCCCCCCC	31.78	28689409
178	Phosphorylation	GSVSTSETPPPPPPN CCCCCCCCCCCCCCC	40.64	22668510
218	Phosphorylation	RRRMDEISDHAKGLT HHHHHHHHHHHCCCC	22.69	30181290
225	Phosphorylation	SDHAKGLTLSDDLER HHHHCCCCCCHHHHH	32.65	28432305
227	Phosphorylation	HAKGLTLSDDLERTV HHCCCCCCHHHHHHH	24.68	21738781
387	Phosphorylation	LKEAEEESSGGEEED HHHHHHHHCCCCCCC	37.25	23712012
388	Phosphorylation	KEAEEESSGGEEEDE HHHHHHHCCCCCCCC	54.84	23712012
403	Phosphorylation	DENIEVVYSKTASVP CCCEEEEEEECCCCC	15.04	28689409
404	Phosphorylation	ENIEVVYSKTASVPK CCEEEEEEECCCCCC	16.36	28689409
406	Phosphorylation	IEVVYSKTASVPKVE EEEEEEECCCCCCEE	20.44	25575281
408	Phosphorylation	VVYSKTASVPKVETV EEEEECCCCCCEEEE	44.15	25575281
414	Phosphorylation	ASVPKVETVKSDNKD CCCCCEEEECCCCCC	35.90	28432305
417	Phosphorylation	PKVETVKSDNKDDDI CCEEEECCCCCCCCC	41.92	21738781

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
174	S	Phosphorylation	Kinase	CSNK2A1	P33674	GPS
174	S	Phosphorylation	Kinase	CSK21	P19139	PhosphoELM
174	S	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
387	S	Phosphorylation	Kinase	CSNK2A1	P33674	GPS
387	S	Phosphorylation	Kinase	CSK21	P19139	PhosphoELM
387	S	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
387	S	Phosphorylation	Kinase	CK2_GROUP	-	PhosphoELM
388	S	Phosphorylation	Kinase	CSNK2A1	P33674	GPS
388	S	Phosphorylation	Kinase	CSK21	P19139	PhosphoELM
388	S	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
388	S	Phosphorylation	Kinase	CK2_GROUP	-	PhosphoELM

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of IF5_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of IF5_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
IF2B_HUMAN	EIF2S2	physical	9395514

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of IF5_RAT

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphorylation of mammalian translation initiation factor 5 (eIF5)in vitro and in vivo."; Majumdar R., Bandyopadhyay A., Deng H., Maitra U.; Nucleic Acids Res. 30:1154-1162(2002). Cited for: PHOSPHORYLATION AT SER-387 AND SER-388.	11861906 [Abstract]