IF3M_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IF3M_HUMAN
• UniProt AC: Q9H2K0
• Protein Name: Translation initiation factor IF-3, mitochondrial
• Gene Name: MTIF3
• Organism: Homo sapiens (Human).
• Sequence Length: 278
• Subcellular Localization: Mitochondrion .
• Protein Description: IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins..
• Protein Sequence: MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
32	Phosphorylation	GKHILQKTAPAQLSP HHHHHHHCCCCCCCC	25.55	26074081
38	Phosphorylation	KTAPAQLSPIASAPR HCCCCCCCCCCCCCC	11.37	26074081
42	Phosphorylation	AQLSPIASAPRLSFL CCCCCCCCCCCEEEE	39.25	26074081
47	Phosphorylation	IASAPRLSFLIHAKA CCCCCCEEEEEEHHH	21.20	26074081
61	Phosphorylation	AFSTAEDTQNEGKKT HCCCHHHHCCCCCCC	25.46	24719451
61	Phosphorylation	AFSTAEDTQNEGKKT HCCCHHHHCCCCCCC	25.46	24719451
73	Phosphorylation	KKTKKNKTAFSNVGR CCCCCCCHHHHHHHH	42.18	23909892
76	Phosphorylation	KKNKTAFSNVGRKIS CCCCHHHHHHHHHHH	28.30	23909892
121	Phosphorylation	LRLVQRNTSTEPAEY HHHHHCCCCCCCHHH	38.93	24719451
121	Phosphorylation	LRLVQRNTSTEPAEY HHHHHCCCCCCCHHH	38.93	30108239
122	Phosphorylation	RLVQRNTSTEPAEYQ HHHHCCCCCCCHHHH	34.03	30108239
123	Phosphorylation	LVQRNTSTEPAEYQL HHHCCCCCCCHHHHH	43.90	30108239
128	Phosphorylation	TSTEPAEYQLMTGLQ CCCCCHHHHHHHHHH	14.73	24043423
132	Phosphorylation	PAEYQLMTGLQILQE CHHHHHHHHHHHHHH	43.25	24043423

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of IF3M_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IF3M_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IF3M_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of IF3M_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.