| UniProt ID | IF3M_HUMAN | |
|---|---|---|
| UniProt AC | Q9H2K0 | |
| Protein Name | Translation initiation factor IF-3, mitochondrial | |
| Gene Name | MTIF3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 278 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.. | |
| Protein Sequence | MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 32 | Phosphorylation | GKHILQKTAPAQLSP HHHHHHHCCCCCCCC | 25.55 | 26074081 | |
| 38 | Phosphorylation | KTAPAQLSPIASAPR HCCCCCCCCCCCCCC | 11.37 | 26074081 | |
| 42 | Phosphorylation | AQLSPIASAPRLSFL CCCCCCCCCCCEEEE | 39.25 | 26074081 | |
| 47 | Phosphorylation | IASAPRLSFLIHAKA CCCCCCEEEEEEHHH | 21.20 | 26074081 | |
| 61 | Phosphorylation | AFSTAEDTQNEGKKT HCCCHHHHCCCCCCC | 25.46 | 24719451 | |
| 61 | Phosphorylation | AFSTAEDTQNEGKKT HCCCHHHHCCCCCCC | 25.46 | 24719451 | |
| 73 | Phosphorylation | KKTKKNKTAFSNVGR CCCCCCCHHHHHHHH | 42.18 | 23909892 | |
| 76 | Phosphorylation | KKNKTAFSNVGRKIS CCCCHHHHHHHHHHH | 28.30 | 23909892 | |
| 121 | Phosphorylation | LRLVQRNTSTEPAEY HHHHHCCCCCCCHHH | 38.93 | 24719451 | |
| 121 | Phosphorylation | LRLVQRNTSTEPAEY HHHHHCCCCCCCHHH | 38.93 | 30108239 | |
| 122 | Phosphorylation | RLVQRNTSTEPAEYQ HHHHCCCCCCCHHHH | 34.03 | 30108239 | |
| 123 | Phosphorylation | LVQRNTSTEPAEYQL HHHCCCCCCCHHHHH | 43.90 | 30108239 | |
| 128 | Phosphorylation | TSTEPAEYQLMTGLQ CCCCCHHHHHHHHHH | 14.73 | 24043423 | |
| 132 | Phosphorylation | PAEYQLMTGLQILQE CHHHHHHHHHHHHHH | 43.25 | 24043423 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IF3M_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IF3M_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IF3M_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of IF3M_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...