UniProt ID | IF2A_SCHPO | |
---|---|---|
UniProt AC | P56286 | |
Protein Name | Eukaryotic translation initiation factor 2 subunit alpha | |
Gene Name | tif211 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 306 | |
Subcellular Localization | ||
Protein Description | eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B (By similarity).. | |
Protein Sequence | MSTTSCRMYENRFPEVDELVVVNVRQIQEMGAYVKLLEYDNIEGMVLLSELSRRRIRSVQKHIRVGRNEVVVVLRVDKEKGYIDLSKRRVSPEDVVKCEERFNKSKAVHSIMRHIAEKHNVPLETMYTTIGWPLYRKYGHAYDAFKLAISNPDHVFEGLEPPKSGVINDLLAQISRRLTPQPIKIRADVEVTCFGYEGINAIKAALKAAEDVHTEEVPIKVKLVAPPLYVLLTNALDKSLGLKKLEEAIGAIEKSITASNGTCTVKMKPKAVSETDELELADLMKKFEKENAEISGDEEDDQSGSE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
49 | Phosphorylation | IEGMVLLSELSRRRI CCHHHHHHHHHHHHH | 32.12 | 29996109 | |
52 | Phosphorylation | MVLLSELSRRRIRSV HHHHHHHHHHHHHHH | 21.49 | 25720772 | |
179 | Phosphorylation | AQISRRLTPQPIKIR HHHHHCCCCCCEEEE | 20.33 | 28889911 | |
273 | Phosphorylation | KMKPKAVSETDELEL EECCCCCCCCCHHHH | 39.37 | 28889911 | |
275 | Phosphorylation | KPKAVSETDELELAD CCCCCCCCCHHHHHH | 27.54 | 29996109 | |
295 | Phosphorylation | EKENAEISGDEEDDQ HHHHCCCCCCCCCCC | 31.53 | 28889911 | |
303 | Phosphorylation | GDEEDDQSGSE---- CCCCCCCCCCC---- | 51.81 | 28889911 | |
305 | Phosphorylation | EEDDQSGSE------ CCCCCCCCC------ | 45.43 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IF2A_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IF2A_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IF2A_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of IF2A_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...