UniProt ID | IDI1_MOUSE | |
---|---|---|
UniProt AC | P58044 | |
Protein Name | Isopentenyl-diphosphate Delta-isomerase 1 | |
Gene Name | Idi1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 227 | |
Subcellular Localization | Peroxisome. | |
Protein Description | Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP).. | |
Protein Sequence | MPEINTSHLDEKQVQLLAEMCILIDENDNKIGADTKKNCHLNENIDKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNSCCSHPLSNPGELEENNAIGVKRAAKRRLKAELGIPLEEVDLNEMDYLTRIYYKAQSDGIWGEHEVDYILFLRKNVTLNPDPNEIKSYCYVSKEEVREILKKAASGEIKLTPWFKIIADTFLFKWWDNLNHLSPFVDHEKIHRL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MPEINTSHLDEKQ --CCCCCHHHCCHHH | 24.16 | 28066266 | |
7 | Phosphorylation | -MPEINTSHLDEKQV -CCCCCHHHCCHHHH | 19.98 | 28066266 | |
37 | Ubiquitination | KIGADTKKNCHLNEN CCCCCCCCCCCCCCC | 67.89 | - | |
47 | Acetylation | HLNENIDKGLLHRAF CCCCCCCCCHHHHHH | 47.89 | 22826441 | |
55 | Phosphorylation | GLLHRAFSVFLFNTE CHHHHHHEEEEEECC | 15.81 | 29514104 | |
71 | Phosphorylation | KLLLQQRSDAKITFP CCCEECCCCCCEECC | 37.27 | 29514104 | |
113 | Ubiquitination | RAAKRRLKAELGIPL HHHHHHHHHHHCCCH | 37.69 | - | |
157 | Ubiquitination | DYILFLRKNVTLNPD CEEEEEECCEECCCC | 58.90 | 27667366 | |
169 | Ubiquitination | NPDPNEIKSYCYVSK CCCHHHHHHHEEECH | 29.24 | - | |
169 | Acetylation | NPDPNEIKSYCYVSK CCCHHHHHHHEEECH | 29.24 | 22826441 | |
170 | Phosphorylation | PDPNEIKSYCYVSKE CCHHHHHHHEEECHH | 26.54 | - | |
176 | Acetylation | KSYCYVSKEEVREIL HHHEEECHHHHHHHH | 48.10 | 21728379 | |
192 | Ubiquitination | KAASGEIKLTPWFKI HHHCCCCCCCHHHHH | 41.84 | - | |
216 | Phosphorylation | WDNLNHLSPFVDHEK HHHCCCCCCCCCHHH | 14.56 | 26745281 | |
223 | Ubiquitination | SPFVDHEKIHRL--- CCCCCHHHHHCC--- | 40.15 | - | |
223 | Acetylation | SPFVDHEKIHRL--- CCCCCHHHHHCC--- | 40.15 | 22826441 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IDI1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IDI1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IDI1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of IDI1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...