UniProt ID | IDHG1_MOUSE | |
---|---|---|
UniProt AC | P70404 | |
Protein Name | Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial | |
Gene Name | Idh3g | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 393 | |
Subcellular Localization | Mitochondrion. | |
Protein Description | Regulatory subunit which plays a role in the allosteric regulation of the enzyme catalyzing the decarboxylation of isocitrate (ICT) into alpha-ketoglutarate. The heterodimer composed of the alpha (IDH3A) and beta (IDH3B) subunits and the heterodimer composed of the alpha (IDH3A) and gamma (IDH3G) subunits, have considerable basal activity but the full activity of the heterotetramer (containing two subunits of IDH3A, one of IDH3B and one of IDH3G) requires the assembly and cooperative function of both heterodimers.. | |
Protein Sequence | MALKVAIAAGGAAKAMLKPTLLCRPWEVLAAHVAPRRSISSQQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAAHYPQITFDSMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENMHTPDIGGQGTTSQAIQDIIRHIRIINGRAVEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
81 | S-nitrosocysteine | KSVFRHACVPVDFEE HHHHHHCCCCCCHHE | 2.65 | - | |
81 | S-palmitoylation | KSVFRHACVPVDFEE HHHHHHCCCCCCHHE | 2.65 | 28526873 | |
130 | Phosphorylation | NLPPSHKSRNNILRT CCCCCHHHHCCHHHH | 34.51 | 23737553 | |
148 | S-nitrosocysteine | LYANVIHCKSLPGVV HHHCEEECCCCCCCE | 1.89 | - | |
148 | S-palmitoylation | LYANVIHCKSLPGVV HHHCEEECCCCCCCE | 1.89 | 26165157 | |
149 | Acetylation | YANVIHCKSLPGVVT HHCEEECCCCCCCEE | 40.65 | 23864654 | |
159 | Acetylation | PGVVTRHKDIDILIV CCCEECCCCCEEEEE | 53.76 | 23864654 | |
170 | Phosphorylation | ILIVRENTEGEYSSL EEEEECCCCCCCCCC | 40.38 | 22324799 | |
174 | Phosphorylation | RENTEGEYSSLEHES ECCCCCCCCCCCHHH | 17.89 | 29472430 | |
175 | Phosphorylation | ENTEGEYSSLEHESV CCCCCCCCCCCHHHH | 24.93 | 29899451 | |
176 | Phosphorylation | NTEGEYSSLEHESVA CCCCCCCCCCHHHHH | 36.55 | 23737553 | |
181 | Phosphorylation | YSSLEHESVAGVVES CCCCCHHHHHHHHHH | 21.12 | 29472430 | |
188 | Phosphorylation | SVAGVVESLKIITKA HHHHHHHHHHHHHHH | 24.29 | 22324799 | |
206 | Succinylation | RIAEYAFKLAQESGR HHHHHHHHHHHHHCC | 34.44 | 26388266 | |
206 | Acetylation | RIAEYAFKLAQESGR HHHHHHHHHHHHHCC | 34.44 | 23576753 | |
226 | Acetylation | VHKANIMKLGDGLFL HHHCCHHHHCCCHHH | 45.59 | 23806337 | |
226 | Succinylation | VHKANIMKLGDGLFL HHHCCHHHHCCCHHH | 45.59 | - | |
226 | Succinylation | VHKANIMKLGDGLFL HHHCCHHHHCCCHHH | 45.59 | 23806337 | |
235 | S-palmitoylation | GDGLFLQCCREVAAH CCCHHHHHHHHHHHH | 2.28 | 28526873 | |
333 | S-palmitoylation | TATLLASCMMLDHLK HHHHHHHHHHHHHHH | 1.22 | 28526873 | |
333 | S-nitrosocysteine | TATLLASCMMLDHLK HHHHHHHHHHHHHHH | 1.22 | - | |
343 | Phosphorylation | LDHLKLHSYATSIRK HHHHHHHHHHHHHHH | 27.22 | 22817900 | |
363 | Phosphorylation | MDNENMHTPDIGGQG CCCCCCCCCCCCCCC | 16.34 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IDHG1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IDHG1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IDHG1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of IDHG1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Proteomic analysis of in vivo phosphorylated synaptic proteins."; Collins M.O., Yu L., Coba M.P., Husi H., Campuzano I.,Blackstock W.P., Choudhary J.S., Grant S.G.; J. Biol. Chem. 280:5972-5982(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-363, AND MASSSPECTROMETRY. |