dbPTM

IDGF5_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	IDGF5_DROME
UniProt AC	Q8T0R7
Protein Name	Chitinase-like protein Idgf5
Gene Name	Idgf5
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	444
Subcellular Localization	Secreted. Secreted in hemolymph. It is probably transported to target tissues via hemolymph..
Protein Description	Probably required to stimulate the proliferation, polarization and motility of imaginal disk cells. May act by stabilizing the binding of insulin-like peptides to its receptor through a simultaneous interaction with both molecules to form a multiprotein signaling complex (By similarity)..
Protein Sequence	MMWIQKNPFLGLLLCSFLAFFQSTYAEVGKLVCFYDAQSFVREGPAQMSLAELEPALQFCNFLVYGYAGIDAVTYKIKSLDPSLTNDRQHYRHITALRKKYPHVRFLLSVGGDRDVNSEGVADSDKYLRLLEQSEHRKSFQASVLAELNNNGFDGIDLAWQFPKNRPKLQQGVFKRVWGSLRGWFSSSSVDEKSEEHREQFATLLEELQSDLRRGGQLLTVSMLPHVSAELFIDVPKVLSNVDFVNLGTYDFQTPERDPKVADLPTPLYAMYDRDPSHNVQYQVQYWMNQTSEISVHKLHVGVTSYGRAWNMTRNSGITGYPPIPAANGAAPPGRQTVTPGLLSWPEICDLLQQQPQDREVPHLRKVGDPTKRFGIYAYRAADDQGENGLWVGYEDPLTAAIKAGFVHAQGLGGVAFHDLSMDDFRGQCAGEKFPILRSIKFKL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
289	N-linked_Glycosylation	YQVQYWMNQTSEISV HEEEHHHHCCCEEEE	28.03	-
311	N-linked_Glycosylation	TSYGRAWNMTRNSGI EHHHCHHCCCCCCCC	22.44	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of IDGF5_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of IDGF5_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of IDGF5_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of IDGF5_DROME !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of IDGF5_DROME

Related Literatures of Post-Translational Modification