UniProt ID | ICMTB_ARATH | |
---|---|---|
UniProt AC | Q93W54 | |
Protein Name | Protein-S-isoprenylcysteine O-methyltransferase B | |
Gene Name | ICMTB | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 197 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Catalyzes the post-translational methylation of isoprenylated C-terminal cysteine residues, resulting in the modulation of the function of prenylated proteins. Involved in negative regulation of abscisic acid signaling. Carboxyl methylation is a reversible and potentially regulated step in the post-translational modification of prenylated proteins.. | |
Protein Sequence | MTEIFSDTGFRQLTQMFLAIIFFHTSEYILAIAIHGASKVTLSSLLISKHYALAMLISVLEYIAEIVFFPGLKQHWWISNFGLTMIILGEILRKTAIITAGRSFTHLIKIRREEHHKLVTEGVYQIMRHPSYSGFLIWSVGTQVMLCNPISAIAFAVVVWRFFAERIPYEEHYLKQFFGRQYVEYAQRVPSGVPFVN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of ICMTB_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ICMTB_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ICMTB_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ICMTB_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NAC89_ARATH | NAC089 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...