ICMTB_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ICMTB_ARATH
• UniProt AC: Q93W54
• Protein Name: Protein-S-isoprenylcysteine O-methyltransferase B
• Gene Name: ICMTB
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 197
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: Catalyzes the post-translational methylation of isoprenylated C-terminal cysteine residues, resulting in the modulation of the function of prenylated proteins. Involved in negative regulation of abscisic acid signaling. Carboxyl methylation is a reversible and potentially regulated step in the post-translational modification of prenylated proteins..
• Protein Sequence: MTEIFSDTGFRQLTQMFLAIIFFHTSEYILAIAIHGASKVTLSSLLISKHYALAMLISVLEYIAEIVFFPGLKQHWWISNFGLTMIILGEILRKTAIITAGRSFTHLIKIRREEHHKLVTEGVYQIMRHPSYSGFLIWSVGTQVMLCNPISAIAFAVVVWRFFAERIPYEEHYLKQFFGRQYVEYAQRVPSGVPFVN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of ICMTB_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ICMTB_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ICMTB_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ICMTB_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NAC89_ARATH	NAC089	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.