dbPTM

IACS_PIG - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	IACS_PIG
UniProt AC	P26461
Protein Name	Sperm-associated acrosin inhibitor
Gene Name
Organism	Sus scrofa (Pig).
Sequence Length	97
Subcellular Localization	Secreted.
Protein Description	Inhibits acrosin..
Protein Sequence	MAFFSSRVRALFILVLVLPLCSETGFARSKKTRKEPDCDVYRSHLFFCTREMDPICGTNGKSYANPCIFCSEKLGRNEKFDFGHWGHCREYTSAARS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of IACS_PIG !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of IACS_PIG !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of IACS_PIG !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of IACS_PIG !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
UBC_HUMAN	UBC	physical	20526895

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of IACS_PIG

Related Literatures of Post-Translational Modification