UniProt ID | HYKK_HUMAN | |
---|---|---|
UniProt AC | A2RU49 | |
Protein Name | Hydroxylysine kinase | |
Gene Name | HYKK | |
Organism | Homo sapiens (Human). | |
Sequence Length | 373 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Catalyzes the GTP-dependent phosphorylation of 5-hydroxy-L-lysine.. | |
Protein Sequence | MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPTEYVLKISNTKASKNPDLIEVQNHIIMFLKAAGFPTASVCHTKGDNTASLVSVDSGSEIKSYLVRLLTYLPGRPIAELPVSPQLLYEIGKLAAKLDKTLQRFHHPKLSSLHRENFIWNLKNVPLLEKYLYALGQNRNREIVEHVIHLFKEEVMTKLSHFRECINHGDLNDHNILIESSKSASGNAEYQVSGILDFGDMSYGYYVFEVAITIMYMMIESKSPIQVGGHVLAGFESITPLTAVEKGALFLLVCSRFCQSLVMAAYSCQLYPENKDYLMVTAKTGWKHLQQMFDMGQKAVEEIWFETAKSYESGISM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
33 | Ubiquitination | VESVFGLKVSKVRPL HHHHHCCCEEEEEEC | 32015554 | ||
42 | Phosphorylation | SKVRPLPSYDDQNFH EEEEECCCCCCCCEE | 29496907 | ||
51 | Phosphorylation | DDQNFHVYVSKTKDG CCCCEEEEEEECCCC | 29496907 | ||
67 | Phosphorylation | TEYVLKISNTKASKN CEEEEEEECCCCCCC | - | ||
102 | Ubiquitination | TASVCHTKGDNTASL CEEEEEECCCCCEEE | 29967540 | ||
179 | Ubiquitination | ENFIWNLKNVPLLEK HHCCHHCCCCHHHHH | 21963094 | ||
186 | Ubiquitination | KNVPLLEKYLYALGQ CCCHHHHHHHHHHCC | 22817900 | ||
186 (in isoform 1) | Ubiquitination | - | 21890473 | ||
186 (in isoform 3) | Ubiquitination | - | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HYKK_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HYKK_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HYKK_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of HYKK_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...