| UniProt ID | HYKK_HUMAN | |
|---|---|---|
| UniProt AC | A2RU49 | |
| Protein Name | Hydroxylysine kinase | |
| Gene Name | HYKK | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 373 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Catalyzes the GTP-dependent phosphorylation of 5-hydroxy-L-lysine.. | |
| Protein Sequence | MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPTEYVLKISNTKASKNPDLIEVQNHIIMFLKAAGFPTASVCHTKGDNTASLVSVDSGSEIKSYLVRLLTYLPGRPIAELPVSPQLLYEIGKLAAKLDKTLQRFHHPKLSSLHRENFIWNLKNVPLLEKYLYALGQNRNREIVEHVIHLFKEEVMTKLSHFRECINHGDLNDHNILIESSKSASGNAEYQVSGILDFGDMSYGYYVFEVAITIMYMMIESKSPIQVGGHVLAGFESITPLTAVEKGALFLLVCSRFCQSLVMAAYSCQLYPENKDYLMVTAKTGWKHLQQMFDMGQKAVEEIWFETAKSYESGISM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 33 | Ubiquitination | VESVFGLKVSKVRPL HHHHHCCCEEEEEEC | 32015554 | ||
| 42 | Phosphorylation | SKVRPLPSYDDQNFH EEEEECCCCCCCCEE | 29496907 | ||
| 51 | Phosphorylation | DDQNFHVYVSKTKDG CCCCEEEEEEECCCC | 29496907 | ||
| 67 | Phosphorylation | TEYVLKISNTKASKN CEEEEEEECCCCCCC | - | ||
| 102 | Ubiquitination | TASVCHTKGDNTASL CEEEEEECCCCCEEE | 29967540 | ||
| 179 | Ubiquitination | ENFIWNLKNVPLLEK HHCCHHCCCCHHHHH | 21963094 | ||
| 186 | Ubiquitination | KNVPLLEKYLYALGQ CCCHHHHHHHHHHCC | 22817900 | ||
| 186 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 186 (in isoform 3) | Ubiquitination | - | 21890473 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HYKK_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HYKK_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HYKK_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of HYKK_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...