dbPTM

HXB1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HXB1_HUMAN
UniProt AC	P14653
Protein Name	Homeobox protein Hox-B1
Gene Name	HOXB1
Organism	Homo sapiens (Human).
Sequence Length	301
Subcellular Localization	Nucleus.
Protein Description	Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures..
Protein Sequence	MDYNRMNSFLEYPLCNRGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREEGRVPPAPPGCPKEAAGDASDQSTCTSPEASPSSVTS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
202	Phosphorylation	VSEPGLGSPSGLRTN CCCCCCCCCCCCCCC	22.42	26699800
204	Phosphorylation	EPGLGSPSGLRTNFT CCCCCCCCCCCCCCC	52.75	26699800
277	Acetylation	PAPPGCPKEAAGDAS CCCCCCCHHHCCCCC	65.15	24884097
284	Phosphorylation	KEAAGDASDQSTCTS HHHCCCCCCCCCCCC	40.71	21118733
295	Phosphorylation	TCTSPEASPSSVTS- CCCCCCCCCCCCCC-	24.53	21118733
297	Phosphorylation	TSPEASPSSVTS--- CCCCCCCCCCCC---	34.64	21118733
298	Phosphorylation	SPEASPSSVTS---- CCCCCCCCCCC----	32.57	21118733
300	Phosphorylation	EASPSSVTS------ CCCCCCCCC------	30.57	21118733
301	Phosphorylation	ASPSSVTS------- CCCCCCCC-------	35.75	21118733

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HXB1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HXB1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HXB1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
PBX1_HUMAN	PBX1	physical	10052460
ZN363_HUMAN	RCHY1	physical	26496426

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HXB1_HUMAN

Related Literatures of Post-Translational Modification