HTAI2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HTAI2_HUMAN
• UniProt AC: Q9BUP3
• Protein Name: Oxidoreductase HTATIP2
• Gene Name: HTATIP2 {ECO:0000312|HGNC:HGNC:16637}
• Organism: Homo sapiens (Human).
• Sequence Length: 242
• Subcellular Localization: Cytoplasm . Nucleus envelope .
• Protein Description: Oxidoreductase required for tumor suppression. NAPDH-bound form inhibits nuclear import by competing with nuclear import substrates for binding to a subset of nuclear transport receptors. May act as a redox sensor linked to transcription through regulation of nuclear import. Isoform 1 is a metastasis suppressor with proapoptotic as well as antiangiogenic properties. Isoform 2 has an antiapoptotic effect..
• Protein Sequence: MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWASGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAETEALSK ------CHHHHHHHH	32.21	22814378
4	Phosphorylation	----MAETEALSKLR ----CHHHHHHHHHH	19.61	20068231
8	Phosphorylation	MAETEALSKLREDFR CHHHHHHHHHHHHHH	36.37	20068231
9	Ubiquitination	AETEALSKLREDFRM HHHHHHHHHHHHHHH	53.03	33845483
20	Phosphorylation	DFRMQNKSVFILGAS HHHHCCCEEEEEECC	29.79	19562805
36 (in isoform 2)	Ubiquitination	-	38.25	21890473
36 (in isoform 1)	Ubiquitination	-	38.25	21890473
36	Ubiquitination	ETGRVLLKEILEQGL HHHHHHHHHHHHCCC	38.25	23000965
43	Ubiquitination	KEILEQGLFSKVTLI HHHHHCCCCCEEEEE	4.35	33845483
45	Phosphorylation	ILEQGLFSKVTLIGR HHHCCCCCEEEEECC	31.12	19060867
46	Ubiquitination	LEQGLFSKVTLIGRR HHCCCCCEEEEECCC	31.72	33845483
54	Ubiquitination	VTLIGRRKLTFDEEA EEEECCCCCCCCHHH	50.98	29967540
56	Phosphorylation	LIGRRKLTFDEEAYK EECCCCCCCCHHHHH	31.88	26657352
62	Phosphorylation	LTFDEEAYKNVNQEV CCCCHHHHHCCCHHH	13.33	30622161
63	Ubiquitination	TFDEEAYKNVNQEVV CCCHHHHHCCCHHHC	62.56	23503661
70 (in isoform 3)	Ubiquitination	-	7.40	21890473
70	Ubiquitination	KNVNQEVVDFEKLDD HCCCHHHCCHHHHHH	7.40	23000965
74	Ubiquitination	QEVVDFEKLDDYASA HHHCCHHHHHHHHHH	58.15	29967540
80	Ubiquitination	EKLDDYASAFQGHDV HHHHHHHHHHCCCCC	24.32	33845483
88	Ubiquitination	AFQGHDVGFCCLGTT HHCCCCCEEEEECCC	18.87	29967540
90 (in isoform 3)	Phosphorylation	-	1.22	27251275
97	Ubiquitination	CCLGTTRGKAGAEGF EEECCCCCCCCCCCE	23.29	23503661
97 (in isoform 3)	Ubiquitination	-	23.29	-
98	Ubiquitination	CLGTTRGKAGAEGFV EECCCCCCCCCCCEE	40.11	27667366
108	Ubiquitination	AEGFVRVDRDYVLKS CCCEEEECHHHHHHH	27.46	29967540
111	Phosphorylation	FVRVDRDYVLKSAEL EEEECHHHHHHHHHH	14.47	-
114	Acetylation	VDRDYVLKSAELAKA ECHHHHHHHHHHHHC	37.26	27452117
114	Ubiquitination	VDRDYVLKSAELAKA ECHHHHHHHHHHHHC	37.26	23503661
115	Phosphorylation	DRDYVLKSAELAKAG CHHHHHHHHHHHHCC	23.86	28064214
120	Ubiquitination	LKSAELAKAGGCKHF HHHHHHHHCCCCCCC	61.25	33845483
131	Phosphorylation	CKHFNLLSSKGADKS CCCCCCCCCCCCCCC	32.92	20873877
132	Phosphorylation	KHFNLLSSKGADKSS CCCCCCCCCCCCCCC	34.77	20873877
132 (in isoform 3)	Ubiquitination	-	34.77	-
132	Ubiquitination	KHFNLLSSKGADKSS CCCCCCCCCCCCCCC	34.77	27667366
133	Ubiquitination	HFNLLSSKGADKSSN CCCCCCCCCCCCCCC	55.53	23000965
137	Ubiquitination	LSSKGADKSSNFLYL CCCCCCCCCCCEEEE	56.07	23000965
137 (in isoform 1)	Ubiquitination	-	56.07	21890473
138	Phosphorylation	SSKGADKSSNFLYLQ CCCCCCCCCCEEEEE	30.94	21712546
139	Phosphorylation	SKGADKSSNFLYLQV CCCCCCCCCEEEEEE	37.02	21712546
147	Ubiquitination	NFLYLQVKGEVEAKV CEEEEEEECEEEEEE	36.07	25015289
148 (in isoform 3)	Ubiquitination	-	45.38	-
148	Ubiquitination	FLYLQVKGEVEAKVE EEEEEEECEEEEEEE	45.38	23503661
153	Ubiquitination	VKGEVEAKVEELKFD EECEEEEEEEECCCC	36.35	29901268
154	Ubiquitination	KGEVEAKVEELKFDR ECEEEEEEEECCCCC	9.96	33845483
158	Ubiquitination	EAKVEELKFDRYSVF EEEEEECCCCCCCCC	48.80	33845483
167	Ubiquitination	DRYSVFRPGVLLCDR CCCCCCCCCEEEEEC	26.27	23000965
171	Ubiquitination	VFRPGVLLCDRQESR CCCCCEEEEECCCCC	2.37	23000965
171 (in isoform 3)	Ubiquitination	-	2.37	21890473
181	Ubiquitination	RQESRPGEWLVRKFF CCCCCCCHHHHHHHH	40.08	25015289
186	Ubiquitination	PGEWLVRKFFGSLPD CCHHHHHHHHCCCCC	37.25	21890473
186 (in isoform 1)	Ubiquitination	-	37.25	21890473
187	Ubiquitination	GEWLVRKFFGSLPDS CHHHHHHHHCCCCCH	6.17	29901268
192	Ubiquitination	RKFFGSLPDSWASGH HHHHCCCCCHHHCCC	34.97	33845483
220	Ubiquitination	NVVRPRDKQMELLEN CCCCCCHHHHHHHHH	53.47	33845483
220 (in isoform 3)	Ubiquitination	-	53.47	21890473
228	Ubiquitination	QMELLENKAIHDLGK HHHHHHHHHHHHHHH	39.07	23000965
228 (in isoform 1)	Ubiquitination	-	39.07	21890473
241	Ubiquitination	GKAHGSLKP------ HHHCCCCCC------	50.83	27667366
254	Ubiquitination	------------------- -------------------		33845483
262 (in isoform 3)	Ubiquitination	-		-
262	Ubiquitination	--------------------------- ---------------------------		23000965
275	Ubiquitination	---------------------------------------- ----------------------------------------		27667366

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HTAI2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HTAI2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HTAI2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NCOA5_HUMAN	NCOA5	physical	15073177
RAB5A_HUMAN	RAB5A	physical	21252234
ACSL4_HUMAN	ACSL4	physical	21252234
SHLB1_HUMAN	SH3GLB1	physical	21252234
NCOA5_HUMAN	NCOA5	physical	28514442
AMOL2_HUMAN	AMOTL2	physical	28514442
ASAH1_HUMAN	ASAH1	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.