dbPTM

HSPR2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HSPR2_ARATH
UniProt AC	O04203
Protein Name	Nematode resistance protein-like HSPRO2
Gene Name	HSPRO2
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	435
Subcellular Localization	Cytoplasm .
Protein Description	Positive regulator of basal resistance..
Protein Sequence	MVDMDWKRKMVSSDLPNSPKLSSKLHVTIPSPFKIVPVSSPISCSAPALCSAYELYLRLPELRKLWSSRDFPQWTSEPILKPALQALEISFRLVFAVCSDTRPYINHREWNRRLDSLITKQIQLVAAICEDEEEEGISAEAPVGGGRSSLSLLPQLATWRRSEALGKKILYTIDNEMSRCKYTLGLGEQNIAGKPNLRYDAICRPNEIYSLKDNPYADHIDNHENQTLYIIHQILESWIYASGNLLNRIVSSIEEEKFGKASNDVYLLEKIWKILAEIEDLHMLMDPEDFLKLKKQLQIKSTGKNDAFCFRSKGLVEMMKMSKDLRQKVPAVLAVEVDPTGGPRLQEAAMKLYARKTECDKIHLLQGMQAVEAAAKSFFFGYRQLVAAMMGSAEMNATASQESCDSLSQIFMEPTYFPSLDAAKTFLGEFWSHLG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
13	Phosphorylation	WKRKMVSSDLPNSPK HHHHHHCCCCCCCCC	31.58	25561503
18	Phosphorylation	VSSDLPNSPKLSSKL HCCCCCCCCCHHCCE	22.82	23111157
171	Phosphorylation	ALGKKILYTIDNEMS HHCCCEEEEECCCHH	12.72	28295753
172	Phosphorylation	LGKKILYTIDNEMSR HCCCEEEEECCCHHC	20.57	28295753
178	Phosphorylation	YTIDNEMSRCKYTLG EEECCCHHCCCEECC	28.48	28295753

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HSPR2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HSPR2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HSPR2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
SNF4_ARATH	SNF4	physical	17028154

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HSPR2_ARATH

Related Literatures of Post-Translational Modification