dbPTM

HSPR1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HSPR1_ARATH
UniProt AC	Q9LY61
Protein Name	Nematode resistance protein-like HSPRO1
Gene Name	HSPRO1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	428
Subcellular Localization	Cytoplasm .
Protein Description	Positive regulator of basal resistance..
Protein Sequence	MADLDLQRKMVSPKLHVTIPEPCKLSSVSSPISSSSSAACSAYELYLRLPELRNLWSSLYFPHWISEPVLKPALQALEITFRLILTVASDTRPYINRREWIRRLDSLTTSQIKIVAAICGDEDNYEENVSAAPVSNGWSSLSLLSEIATCRTSESVGQKILSTIENEMRWCKYTLGLGEPNLAGKPYLQYDAVCLPEELHSLKNNPYADHIENQENQMLYTSHQILESWIYVSVNLLYRIESRIEEGKFEKASSDVYLLERIWKLLSEIEDLHILMDPEDFLKVKKQLQIKSTFPNDAFCFRSKGLVEMAKMSKELRQKVPAVLEVEVDPTGGPRLQEAAMKLYSRKTEYEKIHLLQGMQAVESAAKRFFFGYQKLVAAMIGNAEANANRTVANHESYDSLTQVFMEPPYYPSLDAAKTFLGEFWSQL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of HSPR1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HSPR1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HSPR1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HSPR1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
SNF4_ARATH	SNF4	physical	17028154
CXE17_ARATH	CXE17	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HSPR1_ARATH

Related Literatures of Post-Translational Modification