| UniProt ID | HSPB8_RAT | |
|---|---|---|
| UniProt AC | Q9EPX0 | |
| Protein Name | Heat shock protein beta-8 | |
| Gene Name | Hspb8 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 196 | |
| Subcellular Localization | Cytoplasm . Nucleus . Translocates to nuclear foci during heat shock. | |
| Protein Description | Displays temperature-dependent chaperone activity.. | |
| Protein Sequence | MADGQLPFPCSYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTAPWPEWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRNPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSPFGESSFNNELPQDNQEVTCS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 24 | Phosphorylation | RRDPFRDSPLSSRLL CCCCCCCCCCHHHHC | 24.39 | 22673903 | |
| 27 | Phosphorylation | PFRDSPLSSRLLDDG CCCCCCCHHHHCCCC | 19.45 | 25575281 | |
| 28 | Phosphorylation | FRDSPLSSRLLDDGF CCCCCCHHHHCCCCC | 34.33 | 25575281 | |
| 57 | Phosphorylation | EWALPRLSSAWPGTL HHHCHHHHHCCCCCC | 21.20 | 22673903 | |
| 58 | Phosphorylation | WALPRLSSAWPGTLR HHCHHHHHCCCCCCC | 38.66 | 22673903 | |
| 63 | Phosphorylation | LSSAWPGTLRSGMVP HHHCCCCCCCCCCCC | 18.21 | - | |
| 71 | Asymmetric dimethylarginine | LRSGMVPRGPTATAR CCCCCCCCCCCCCEE | 52.92 | - | |
| 71 | Methylation | LRSGMVPRGPTATAR CCCCCCCCCCCCCEE | 52.92 | 26494659 | |
| 78 | Asymmetric dimethylarginine | RGPTATARFGVPAEG CCCCCCEECCCCCCC | 25.21 | - | |
| 78 | Methylation | RGPTATARFGVPAEG CCCCCCEECCCCCCC | 25.21 | 26494665 | |
| 137 | Acetylation | QEGGIVSKNFTKKIQ CCCCEECCCCCCCCC | 45.23 | 22902405 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HSPB8_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HSPB8_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HSPB8_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of HSPB8_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
