UniProt ID | HSPB1_CHICK | |
---|---|---|
UniProt AC | Q00649 | |
Protein Name | Heat shock protein beta-1 | |
Gene Name | HSPB1 | |
Organism | Gallus gallus (Chicken). | |
Sequence Length | 193 | |
Subcellular Localization | Cytoplasm . Nucleus . Cytoplasm, cytoskeleton, spindle . | |
Protein Description | Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Plays a role in stress resistance and actin organization.. | |
Protein Sequence | MAERRVPFTFLTSPSWEPFRDWYHGSRLFDQSFGMPHIPEDWYKWPSGSAWPGYFRLLPSESALLPAPGSPYGRALSELSSGISEIRQSADSWKVTLDVNHFAPEELVVKTKDNIVEITGKHEEKQDEHGFISRCFTRKYTLPPGVEATAVRSSLSPDGMLTVEAPLPKPAIQSSEITIPVTVEAKKEEPAKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Phosphorylation | FTFLTSPSWEPFRDW EEEECCCCCCCCHHH | 43.78 | - | |
70 | Phosphorylation | ALLPAPGSPYGRALS CCCCCCCCHHHHHHH | 17.56 | 23106611 | |
77 | Phosphorylation | SPYGRALSELSSGIS CHHHHHHHHHHHCHH | 35.19 | - | |
80 | Phosphorylation | GRALSELSSGISEIR HHHHHHHHHCHHHHH | 23.59 | - | |
81 | Phosphorylation | RALSELSSGISEIRQ HHHHHHHHCHHHHHH | 53.42 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HSPB1_CHICK !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HSPB1_CHICK !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HSPB1_CHICK !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of HSPB1_CHICK !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...