| UniProt ID | HSPB1_CHICK | |
|---|---|---|
| UniProt AC | Q00649 | |
| Protein Name | Heat shock protein beta-1 | |
| Gene Name | HSPB1 | |
| Organism | Gallus gallus (Chicken). | |
| Sequence Length | 193 | |
| Subcellular Localization | Cytoplasm . Nucleus . Cytoplasm, cytoskeleton, spindle . | |
| Protein Description | Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Plays a role in stress resistance and actin organization.. | |
| Protein Sequence | MAERRVPFTFLTSPSWEPFRDWYHGSRLFDQSFGMPHIPEDWYKWPSGSAWPGYFRLLPSESALLPAPGSPYGRALSELSSGISEIRQSADSWKVTLDVNHFAPEELVVKTKDNIVEITGKHEEKQDEHGFISRCFTRKYTLPPGVEATAVRSSLSPDGMLTVEAPLPKPAIQSSEITIPVTVEAKKEEPAKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 15 | Phosphorylation | FTFLTSPSWEPFRDW EEEECCCCCCCCHHH | 43.78 | - | |
| 70 | Phosphorylation | ALLPAPGSPYGRALS CCCCCCCCHHHHHHH | 17.56 | 23106611 | |
| 77 | Phosphorylation | SPYGRALSELSSGIS CHHHHHHHHHHHCHH | 35.19 | - | |
| 80 | Phosphorylation | GRALSELSSGISEIR HHHHHHHHHCHHHHH | 23.59 | - | |
| 81 | Phosphorylation | RALSELSSGISEIRQ HHHHHHHHCHHHHHH | 53.42 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HSPB1_CHICK !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HSPB1_CHICK !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HSPB1_CHICK !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of HSPB1_CHICK !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...