UniProt ID | HSBP1_MOUSE | |
---|---|---|
UniProt AC | Q9CQZ1 | |
Protein Name | Heat shock factor-binding protein 1 | |
Gene Name | Hsbp1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 76 | |
Subcellular Localization | Nucleus. | |
Protein Description | Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process (By similarity).. | |
Protein Sequence | MAETDPKTMQDITLVVETLLQQMQDKFQIMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELDPENKIPTAQKS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
42 | Phosphorylation | IGRIDDMSSRIDDLE HHHHHHHHHHHHHHH | 24.37 | 29472430 | |
43 | Phosphorylation | GRIDDMSSRIDDLEK HHHHHHHHHHHHHHH | 26.98 | 29472430 | |
72 | Phosphorylation | DPENKIPTAQKS--- CCCCCCCCCCCC--- | 45.23 | 26745281 | |
75 | Acetylation | NKIPTAQKS------ CCCCCCCCC------ | 56.52 | 30986447 | |
75 | Ubiquitination | NKIPTAQKS------ CCCCCCCCC------ | 56.52 | - | |
76 | Phosphorylation | KIPTAQKS------- CCCCCCCC------- | 33.12 | 26745281 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HSBP1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HSBP1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HSBP1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of HSBP1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...