HSBP1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HSBP1_MOUSE
• UniProt AC: Q9CQZ1
• Protein Name: Heat shock factor-binding protein 1
• Gene Name: Hsbp1
• Organism: Mus musculus (Mouse).
• Sequence Length: 76
• Subcellular Localization: Nucleus.
• Protein Description: Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process (By similarity)..
• Protein Sequence: MAETDPKTMQDITLVVETLLQQMQDKFQIMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELDPENKIPTAQKS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
42	Phosphorylation	IGRIDDMSSRIDDLE HHHHHHHHHHHHHHH	24.37	29472430
43	Phosphorylation	GRIDDMSSRIDDLEK HHHHHHHHHHHHHHH	26.98	29472430
72	Phosphorylation	DPENKIPTAQKS--- CCCCCCCCCCCC---	45.23	26745281
75	Acetylation	NKIPTAQKS------ CCCCCCCCC------	56.52	30986447
75	Ubiquitination	NKIPTAQKS------ CCCCCCCCC------	56.52	-
76	Phosphorylation	KIPTAQKS------- CCCCCCCC-------	33.12	26745281

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HSBP1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HSBP1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HSBP1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of HSBP1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.