UniProt ID | HS25P_ARATH | |
---|---|---|
UniProt AC | P31170 | |
Protein Name | Heat shock protein 21, chloroplastic {ECO:0000303|PubMed:2038305} | |
Gene Name | HSP21 {ECO:0000303|PubMed:2038305} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 227 | |
Subcellular Localization | Plastid, chloroplast stroma, chloroplast nucleoid . | |
Protein Description | Chaperone protein required for seedling and chloroplast development under heat stress, probably by maintaining plastid-encoded RNA polymerase (PEP)-dependent transcription.. | |
Protein Sequence | MASTLSFAASALCSPLAPSPSVSSKSATPFSVSFPRKIPSRIRAQDQRENSIDVVQQGQQKGNQGSSVEKRPQQRLTMDVSPFGLLDPLSPMRTMRQMLDTMDRMFEDTMPVSGRNRGGSGVSEIRAPWDIKEEEHEIKMRFDMPGLSKEDVKISVEDNVLVIKGEQKKEDSDDSWSGRSVSSYGTRLQLPDNCEKDKIKAELKNGVLFITIPKTKVERKVIDVQIQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
35 | Sulfoxidation | TPFSVSFPRKIPSRI CCCEECCCCCCCHHH | 29.20 | 15680227 | |
49 | Sulfoxidation | IRAQDQRENSIDVVQ HHHHHHHHCCCCHHH | 50.09 | 15680227 | |
52 | Sulfoxidation | QDQRENSIDVVQQGQ HHHHHCCCCHHHHHH | 7.60 | 15680227 | |
55 | Sulfoxidation | RENSIDVVQQGQQKG HHCCCCHHHHHHHCC | 2.89 | 15680227 | |
59 | Sulfoxidation | IDVVQQGQQKGNQGS CCHHHHHHHCCCCCC | 37.16 | 15680227 | |
62 | Sulfoxidation | VQQGQQKGNQGSSVE HHHHHHCCCCCCCCC | 27.62 | 15680227 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HS25P_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HS25P_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HS25P_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RPOB_ARATH | rpoB | physical | 23922206 | |
MDHP_ARATH | MDH | physical | 22851138 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...