dbPTM

HS25P_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HS25P_ARATH
UniProt AC	P31170
Protein Name	Heat shock protein 21, chloroplastic {ECO:0000303\|PubMed:2038305}
Gene Name	HSP21 {ECO:0000303\|PubMed:2038305}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	227
Subcellular Localization	Plastid, chloroplast stroma, chloroplast nucleoid .
Protein Description	Chaperone protein required for seedling and chloroplast development under heat stress, probably by maintaining plastid-encoded RNA polymerase (PEP)-dependent transcription..
Protein Sequence	MASTLSFAASALCSPLAPSPSVSSKSATPFSVSFPRKIPSRIRAQDQRENSIDVVQQGQQKGNQGSSVEKRPQQRLTMDVSPFGLLDPLSPMRTMRQMLDTMDRMFEDTMPVSGRNRGGSGVSEIRAPWDIKEEEHEIKMRFDMPGLSKEDVKISVEDNVLVIKGEQKKEDSDDSWSGRSVSSYGTRLQLPDNCEKDKIKAELKNGVLFITIPKTKVERKVIDVQIQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
35	Sulfoxidation	TPFSVSFPRKIPSRI CCCEECCCCCCCHHH	29.20	15680227
49	Sulfoxidation	IRAQDQRENSIDVVQ HHHHHHHHCCCCHHH	50.09	15680227
52	Sulfoxidation	QDQRENSIDVVQQGQ HHHHHCCCCHHHHHH	7.60	15680227
55	Sulfoxidation	RENSIDVVQQGQQKG HHCCCCHHHHHHHCC	2.89	15680227
59	Sulfoxidation	IDVVQQGQQKGNQGS CCHHHHHHHCCCCCC	37.16	15680227
62	Sulfoxidation	VQQGQQKGNQGSSVE HHHHHHCCCCCCCCC	27.62	15680227

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HS25P_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HS25P_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HS25P_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
RPOB_ARATH	rpoB	physical	23922206
MDHP_ARATH	MDH	physical	22851138

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HS25P_ARATH

Related Literatures of Post-Translational Modification