| UniProt ID | HPSE3_ARATH | |
|---|---|---|
| UniProt AC | Q9FZP1 | |
| Protein Name | Heparanase-like protein 3 | |
| Gene Name | At5g34940 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 536 | |
| Subcellular Localization |
Lysosome membrane Peripheral membrane protein. Secreted. |
|
| Protein Description | Endoglycosidase which is a cell surface and extracellular matrix-degrading enzyme. Cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans (By similarity).. | |
| Protein Sequence | MAYRQILAIVLFLCVFQFLDCTVSSAVEENGTVFVYGRAAVGTIDEDFICATLDWWPPEKCDYGSCSWDHASILNLDLNNVILQNAIKAFAPLKIRIGGTLQDIVIYETPDSKQPCLPFTKNSSILFGYTQGCLPMRRWDELNAFFRKTGTKVIFGLNALSGRSIKSNGEAIGAWNYTNAESFIRFTAENNYTIDGWELGNELCGSGVGARVGANQYAIDTINLRNIVNRVYKNVSPMPLVIGPGGFFEVDWFTEYLNKAENSLNATTRHIYDLGPGVDEHLIEKILNPSYLDQEAKSFRSLKNIIKNSSTKAVAWVGESGGAYNSGRNLVSNAFVYSFWYLDQLGMASLYDTKTYCRQSLIGGNYGLLNTTNFTPNPDYYSALIWRQLMGRKALFTTFSGTKKIRSYTHCARQSKGITVLLMNLDNTTTVVAKVELNNSFSLRHTKHMKSYKRASSQLFGGPNGVIQREEYHLTAKDGNLHSQTMLLNGNALQVNSMGDLPPIEPIHINSTEPITIAPYSIVFVHMRNVVVPACA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 30 | N-linked_Glycosylation | VSSAVEENGTVFVYG CHHHHHHCCEEEEEE | 37.62 | - | |
| 122 | N-linked_Glycosylation | PCLPFTKNSSILFGY CCCCCCCCCEEEEEE | 37.62 | - | |
| 176 | N-linked_Glycosylation | GEAIGAWNYTNAESF CEEECCCCCCCHHHH | 32.96 | - | |
| 191 | N-linked_Glycosylation | IRFTAENNYTIDGWE EEEEEECCEEECCEE | 27.16 | - | |
| 265 | N-linked_Glycosylation | NKAENSLNATTRHIY HHHHHCCCCCCHHHH | 34.75 | - | |
| 272 | Phosphorylation | NATTRHIYDLGPGVD CCCCHHHHHCCCCCC | 10.05 | 22074104 | |
| 308 | N-linked_Glycosylation | SLKNIIKNSSTKAVA HHHHHHHCCCCCEEE | 30.68 | - | |
| 370 | N-linked_Glycosylation | GGNYGLLNTTNFTPN CCCCCCCCCCCCCCC | 50.31 | - | |
| 427 | N-linked_Glycosylation | VLLMNLDNTTTVVAK EEEEECCCCCEEEEE | 42.35 | - | |
| 438 | N-linked_Glycosylation | VVAKVELNNSFSLRH EEEEEEECCCCCCCC | 28.70 | - | |
| 510 | N-linked_Glycosylation | PIEPIHINSTEPITI CCCCEEECCCCCEEE | 28.81 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HPSE3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HPSE3_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HPSE3_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of HPSE3_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
